Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3177556..3177778 | Replicon | chromosome |
Accession | NZ_AP025214 | ||
Organism | Escherichia coli strain 2017.09.02CC |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A4T4QR47 |
Locus tag | LPH32_RS15515 | Protein ID | WP_000170735.1 |
Coordinates | 3177671..3177778 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3177556..3177614 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPH32_RS15490 | 3172944..3173927 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
LPH32_RS15495 | 3173924..3174928 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
LPH32_RS15500 | 3174958..3176229 | - | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
LPH32_RS15505 | 3176705..3176812 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
LPH32_RS15510 | 3177188..3177295 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 3177556..3177614 | - | 59 | - | - | Antitoxin |
LPH32_RS15515 | 3177671..3177778 | + | 108 | WP_000170735.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
LPH32_RS15520 | 3177865..3179544 | - | 1680 | WP_053290823.1 | cellulose biosynthesis protein BcsG | - |
LPH32_RS15525 | 3179541..3179732 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
LPH32_RS15530 | 3179729..3181300 | - | 1572 | WP_072153691.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
LPH32_RS15535 | 3181573..3181761 | + | 189 | WP_001063315.1 | cellulose biosynthesis protein BcsR | - |
LPH32_RS15540 | 3181773..3182525 | + | 753 | WP_000279544.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3896.73 Da Isoelectric Point: 9.0157
>T40135 WP_000170735.1 NZ_AP025214:3177671-3177778 [Escherichia coli]
MTLAELGMAFWHDLAAPIIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPIIAGILASMIVNWLNKRK
Download Length: 108 bp
>T40135 NZ_AP025214:3177671-3177778 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGATCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGATCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT40135 NZ_AP025214:c3177614-3177556 [Escherichia coli]
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|