Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3176590..3176812 | Replicon | chromosome |
| Accession | NZ_AP025214 | ||
| Organism | Escherichia coli strain 2017.09.02CC | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A829L523 |
| Locus tag | LPH32_RS15505 | Protein ID | WP_000170738.1 |
| Coordinates | 3176705..3176812 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3176590..3176656 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPH32_RS15485 | 3172031..3172933 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| LPH32_RS15490 | 3172944..3173927 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| LPH32_RS15495 | 3173924..3174928 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| LPH32_RS15500 | 3174958..3176229 | - | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
| - | 3176590..3176656 | - | 67 | - | - | Antitoxin |
| LPH32_RS15505 | 3176705..3176812 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| LPH32_RS15510 | 3177188..3177295 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| LPH32_RS15515 | 3177671..3177778 | + | 108 | WP_000170735.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| LPH32_RS15520 | 3177865..3179544 | - | 1680 | WP_053290823.1 | cellulose biosynthesis protein BcsG | - |
| LPH32_RS15525 | 3179541..3179732 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| LPH32_RS15530 | 3179729..3181300 | - | 1572 | WP_072153691.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| LPH32_RS15535 | 3181573..3181761 | + | 189 | WP_001063315.1 | cellulose biosynthesis protein BcsR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T40134 WP_000170738.1 NZ_AP025214:3176705-3176812 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
>T40134 NZ_AP025214:3176705-3176812 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATAGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATAGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT40134 NZ_AP025214:c3176656-3176590 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|