Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2184861..2185078 | Replicon | chromosome |
Accession | NZ_AP025177 | ||
Organism | Staphylococcus aureus strain TPS6281 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | CC22TP_RS10840 | Protein ID | WP_075583739.1 |
Coordinates | 2184974..2185078 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2184861..2184916 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CC22TP_RS10815 | 2180917..2181582 | - | 666 | WP_001024097.1 | SDR family oxidoreductase | - |
CC22TP_RS10820 | 2181734..2182054 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
CC22TP_RS10825 | 2182056..2183036 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
CC22TP_RS10830 | 2183302..2184393 | + | 1092 | WP_000495680.1 | hypothetical protein | - |
- | 2184861..2184916 | + | 56 | - | - | Antitoxin |
CC22TP_RS10840 | 2184974..2185078 | - | 105 | WP_075583739.1 | hypothetical protein | Toxin |
CC22TP_RS10845 | 2185176..2185337 | - | 162 | Protein_2098 | helix-turn-helix domain-containing protein | - |
CC22TP_RS10850 | 2185755..2185913 | + | 159 | WP_024928151.1 | hypothetical protein | - |
CC22TP_RS10855 | 2186573..2187430 | - | 858 | WP_000370944.1 | HAD family hydrolase | - |
CC22TP_RS10860 | 2187498..2188280 | - | 783 | WP_217654596.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3861.73 Da Isoelectric Point: 7.0039
>T40012 WP_075583739.1 NZ_AP025177:c2185078-2184974 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
Download Length: 105 bp
>T40012 NZ_AP025177:c2185078-2184974 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTAATCAAGGCCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTAATCAAGGCCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT40012 NZ_AP025177:2184861-2184916 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|