Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1854675..1854855 | Replicon | chromosome |
| Accession | NZ_AP025177 | ||
| Organism | Staphylococcus aureus strain TPS6281 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CC22TP_RS08895 | Protein ID | WP_001801861.1 |
| Coordinates | 1854675..1854770 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1854798..1854855 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CC22TP_RS08865 | 1850131..1850771 | - | 641 | Protein_1745 | ImmA/IrrE family metallo-endopeptidase | - |
| CC22TP_RS08870 | 1851179..1851946 | - | 768 | WP_001095317.1 | IS21-like element helper ATPase IstB | - |
| CC22TP_RS08875 | 1851958..1853193 | - | 1236 | WP_001215400.1 | IS21 family transposase | - |
| CC22TP_RS08880 | 1853291..1853452 | - | 162 | WP_217654656.1 | hypothetical protein | - |
| CC22TP_RS08885 | 1853463..1853846 | - | 384 | WP_000070809.1 | hypothetical protein | - |
| CC22TP_RS08890 | 1854028..1854252 | - | 225 | WP_001805677.1 | IS3 family transposase | - |
| CC22TP_RS08895 | 1854675..1854770 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1854798..1854855 | - | 58 | - | - | Antitoxin |
| CC22TP_RS08900 | 1854893..1854994 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| CC22TP_RS08905 | 1854972..1855144 | - | 173 | Protein_1753 | transposase | - |
| CC22TP_RS08910 | 1855338..1855715 | - | 378 | WP_001036002.1 | DUF1433 domain-containing protein | - |
| CC22TP_RS08915 | 1855921..1856361 | - | 441 | WP_000759947.1 | DUF1433 domain-containing protein | - |
| CC22TP_RS08920 | 1856406..1858019 | + | 1614 | WP_000926708.1 | lipase | - |
| CC22TP_RS08925 | 1858034..1858333 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| CC22TP_RS08930 | 1858648..1859829 | - | 1182 | WP_000162901.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk | 1825323..1871083 | 45760 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T40004 WP_001801861.1 NZ_AP025177:1854675-1854770 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T40004 NZ_AP025177:1854675-1854770 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT40004 NZ_AP025177:c1854855-1854798 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|