Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1898460..1898640 | Replicon | chromosome |
Accession | NZ_AP025176 | ||
Organism | Staphylococcus aureus strain TPS5614 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | LPC25_RS09170 | Protein ID | WP_001801861.1 |
Coordinates | 1898460..1898555 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1898583..1898640 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPC25_RS09135 | 1894241..1894867 | + | 627 | WP_000669029.1 | hypothetical protein | - |
LPC25_RS09140 | 1894908..1895249 | + | 342 | WP_000627535.1 | DUF3969 family protein | - |
LPC25_RS09145 | 1895350..1895922 | + | 573 | WP_000414208.1 | hypothetical protein | - |
LPC25_RS09150 | 1896119..1896759 | - | 641 | Protein_1805 | ImmA/IrrE family metallo-endopeptidase | - |
LPC25_RS09155 | 1897061..1897237 | - | 177 | WP_000375476.1 | hypothetical protein | - |
LPC25_RS09160 | 1897248..1897631 | - | 384 | WP_000070809.1 | hypothetical protein | - |
LPC25_RS09165 | 1897813..1898037 | - | 225 | WP_001805677.1 | IS3 family transposase | - |
LPC25_RS09170 | 1898460..1898555 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1898583..1898640 | - | 58 | - | - | Antitoxin |
LPC25_RS09175 | 1898678..1898779 | + | 102 | WP_001791232.1 | hypothetical protein | - |
LPC25_RS09180 | 1898757..1898929 | - | 173 | Protein_1811 | transposase | - |
LPC25_RS09185 | 1899123..1899500 | - | 378 | WP_001036002.1 | DUF1433 domain-containing protein | - |
LPC25_RS09190 | 1899706..1900146 | - | 441 | WP_000759947.1 | DUF1433 domain-containing protein | - |
LPC25_RS09195 | 1900191..1901804 | + | 1614 | WP_000926708.1 | lipase | - |
LPC25_RS09200 | 1901819..1902118 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
LPC25_RS09205 | 1902433..1903614 | - | 1182 | WP_000162901.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 1891682..1914868 | 23186 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T39988 WP_001801861.1 NZ_AP025176:1898460-1898555 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T39988 NZ_AP025176:1898460-1898555 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT39988 NZ_AP025176:c1898640-1898583 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|