Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2543843..2544027 | Replicon | chromosome |
Accession | NZ_AP024742 | ||
Organism | Staphylococcus aureus strain 59736 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | OCX51_RS12810 | Protein ID | WP_000482647.1 |
Coordinates | 2543920..2544027 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2543843..2543903 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCX51_RS12795 | 2539317..2539484 | - | 168 | WP_001790576.1 | hypothetical protein | - |
OCX51_RS12800 | 2539715..2541448 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
OCX51_RS12805 | 2541473..2543236 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein | - |
- | 2543843..2543903 | + | 61 | - | - | Antitoxin |
OCX51_RS12810 | 2543920..2544027 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OCX51_RS12815 | 2544161..2544547 | - | 387 | WP_000779360.1 | flippase GtxA | - |
OCX51_RS12820 | 2544805..2545947 | + | 1143 | WP_001176871.1 | glycerate kinase | - |
OCX51_RS12825 | 2546007..2546666 | + | 660 | WP_000831301.1 | membrane protein | - |
OCX51_RS12830 | 2546848..2548059 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
OCX51_RS12835 | 2548182..2548655 | - | 474 | WP_000456497.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T39419 WP_000482647.1 NZ_AP024742:c2544027-2543920 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T39419 NZ_AP024742:c2544027-2543920 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT39419 NZ_AP024742:2543843-2543903 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|