Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2265529..2265745 | Replicon | chromosome |
Accession | NZ_AP024742 | ||
Organism | Staphylococcus aureus strain 59736 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OCX51_RS11350 | Protein ID | WP_001802298.1 |
Coordinates | 2265641..2265745 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2265529..2265584 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCX51_RS11325 | 2261789..2262454 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
OCX51_RS11330 | 2262606..2262926 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OCX51_RS11335 | 2262928..2263908 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
OCX51_RS11340 | 2264174..2265265 | + | 1092 | WP_000495683.1 | hypothetical protein | - |
- | 2265529..2265584 | + | 56 | - | - | Antitoxin |
OCX51_RS11350 | 2265641..2265745 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
OCX51_RS11355 | 2266262..2266432 | + | 171 | WP_001792292.1 | transposase | - |
OCX51_RS11360 | 2266425..2266583 | + | 159 | WP_001792784.1 | hypothetical protein | - |
OCX51_RS11365 | 2267242..2268099 | - | 858 | WP_000370917.1 | HAD family hydrolase | - |
OCX51_RS11370 | 2268167..2268949 | - | 783 | WP_000908178.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T39415 WP_001802298.1 NZ_AP024742:c2265745-2265641 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T39415 NZ_AP024742:c2265745-2265641 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT39415 NZ_AP024742:2265529-2265584 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|