Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2262341..2262538 | Replicon | chromosome |
Accession | NZ_AP024738 | ||
Organism | Staphylococcus aureus strain 59731 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OCX20_RS11335 | Protein ID | WP_001802298.1 |
Coordinates | 2262434..2262538 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2262341..2262379 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCX20_RS11310 | 2258582..2259247 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
OCX20_RS11315 | 2259399..2259719 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OCX20_RS11320 | 2259721..2260701 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
OCX20_RS11325 | 2260967..2262058 | + | 1092 | WP_000495683.1 | hypothetical protein | - |
OCX20_RS11330 | 2262321..2262395 | + | 75 | Protein_2193 | hypothetical protein | - |
- | 2262341..2262379 | + | 39 | - | - | Antitoxin |
OCX20_RS11335 | 2262434..2262538 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
OCX20_RS11340 | 2263218..2263376 | + | 159 | WP_001792784.1 | hypothetical protein | - |
OCX20_RS11345 | 2264035..2264892 | - | 858 | WP_000370917.1 | HAD family hydrolase | - |
OCX20_RS11350 | 2264960..2265742 | - | 783 | WP_000908178.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T39397 WP_001802298.1 NZ_AP024738:c2262538-2262434 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T39397 NZ_AP024738:c2262538-2262434 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT39397 NZ_AP024738:2262341-2262379 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|