Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1928323..1928505 | Replicon | chromosome |
Accession | NZ_AP024738 | ||
Organism | Staphylococcus aureus strain 59731 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | OCX20_RS09400 | Protein ID | WP_001801861.1 |
Coordinates | 1928323..1928418 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1928446..1928505 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCX20_RS09365 | 1923993..1924619 | + | 627 | WP_000669017.1 | hypothetical protein | - |
OCX20_RS09370 | 1924660..1925001 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
OCX20_RS09375 | 1925102..1925674 | + | 573 | WP_000414202.1 | hypothetical protein | - |
OCX20_RS09380 | 1925872..1926500 | - | 629 | Protein_1847 | ImmA/IrrE family metallo-endopeptidase | - |
OCX20_RS09385 | 1926803..1926979 | - | 177 | WP_000375477.1 | hypothetical protein | - |
OCX20_RS09390 | 1926990..1927373 | - | 384 | Protein_1849 | hypothetical protein | - |
OCX20_RS09395 | 1927977..1928120 | - | 144 | WP_001549059.1 | transposase | - |
OCX20_RS09400 | 1928323..1928418 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1928446..1928505 | - | 60 | - | - | Antitoxin |
OCX20_RS09405 | 1928541..1928642 | + | 102 | WP_001791893.1 | hypothetical protein | - |
OCX20_RS09410 | 1928620..1928796 | - | 177 | Protein_1853 | transposase | - |
OCX20_RS09415 | 1928990..1929367 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1921642..1947025 | 25383 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T39387 WP_001801861.1 NZ_AP024738:1928323-1928418 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T39387 NZ_AP024738:1928323-1928418 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT39387 NZ_AP024738:c1928505-1928446 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|