Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2250019..2250235 | Replicon | chromosome |
Accession | NZ_AP024736 | ||
Organism | Staphylococcus aureus strain 59709 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OCX48_RS11290 | Protein ID | WP_001802298.1 |
Coordinates | 2250131..2250235 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2250019..2250074 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCX48_RS11265 | 2246279..2246944 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
OCX48_RS11270 | 2247096..2247416 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OCX48_RS11275 | 2247418..2248398 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
OCX48_RS11280 | 2248664..2249755 | + | 1092 | WP_000495683.1 | hypothetical protein | - |
- | 2250019..2250074 | + | 56 | - | - | Antitoxin |
OCX48_RS11290 | 2250131..2250235 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
OCX48_RS11295 | 2250915..2251073 | + | 159 | WP_001792784.1 | hypothetical protein | - |
OCX48_RS11300 | 2251732..2252589 | - | 858 | WP_000370917.1 | HAD family hydrolase | - |
OCX48_RS11305 | 2252657..2253439 | - | 783 | WP_000908178.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T39375 WP_001802298.1 NZ_AP024736:c2250235-2250131 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T39375 NZ_AP024736:c2250235-2250131 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT39375 NZ_AP024736:2250019-2250074 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|