Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2213419..2213616 | Replicon | chromosome |
Accession | NZ_AP024732 | ||
Organism | Staphylococcus aureus strain 59621 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OCX17_RS11030 | Protein ID | WP_001802298.1 |
Coordinates | 2213512..2213616 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2213419..2213457 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCX17_RS11005 | 2209660..2210325 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
OCX17_RS11010 | 2210477..2210797 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OCX17_RS11015 | 2210799..2211779 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
OCX17_RS11020 | 2212045..2213136 | + | 1092 | WP_000495683.1 | hypothetical protein | - |
OCX17_RS11025 | 2213399..2213473 | + | 75 | Protein_2131 | hypothetical protein | - |
- | 2213419..2213457 | + | 39 | - | - | Antitoxin |
OCX17_RS11030 | 2213512..2213616 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
OCX17_RS11035 | 2214296..2214454 | + | 159 | WP_001792784.1 | hypothetical protein | - |
OCX17_RS11040 | 2215104..2215961 | - | 858 | WP_000370917.1 | HAD family hydrolase | - |
OCX17_RS11045 | 2216029..2216811 | - | 783 | WP_000908178.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T39337 WP_001802298.1 NZ_AP024732:c2213616-2213512 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T39337 NZ_AP024732:c2213616-2213512 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT39337 NZ_AP024732:2213419-2213457 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|