Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1879447..1879629 | Replicon | chromosome |
Accession | NZ_AP024732 | ||
Organism | Staphylococcus aureus strain 59621 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | OCX17_RS09095 | Protein ID | WP_001801861.1 |
Coordinates | 1879447..1879542 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1879570..1879629 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCX17_RS09060 | 1875117..1875743 | + | 627 | WP_000669017.1 | hypothetical protein | - |
OCX17_RS09065 | 1875784..1876125 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
OCX17_RS09070 | 1876226..1876798 | + | 573 | WP_000414202.1 | hypothetical protein | - |
OCX17_RS09075 | 1876996..1877624 | - | 629 | Protein_1785 | ImmA/IrrE family metallo-endopeptidase | - |
OCX17_RS09080 | 1877927..1878103 | - | 177 | WP_000375477.1 | hypothetical protein | - |
OCX17_RS09085 | 1878114..1878497 | - | 384 | Protein_1787 | hypothetical protein | - |
OCX17_RS09090 | 1879101..1879244 | - | 144 | WP_001549059.1 | transposase | - |
OCX17_RS09095 | 1879447..1879542 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1879570..1879629 | - | 60 | - | - | Antitoxin |
OCX17_RS09100 | 1879665..1879766 | + | 102 | WP_001791893.1 | hypothetical protein | - |
OCX17_RS09105 | 1879744..1879920 | - | 177 | Protein_1791 | transposase | - |
OCX17_RS09110 | 1880114..1880491 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1872766..1898149 | 25383 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T39327 WP_001801861.1 NZ_AP024732:1879447-1879542 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T39327 NZ_AP024732:1879447-1879542 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT39327 NZ_AP024732:c1879629-1879570 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|