Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1924963..1925145 | Replicon | chromosome |
| Accession | NZ_AP024730 | ||
| Organism | Staphylococcus aureus strain 59574 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | OCX16_RS09385 | Protein ID | WP_001801861.1 |
| Coordinates | 1924963..1925058 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1925086..1925145 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCX16_RS09350 | 1920633..1921259 | + | 627 | WP_000669017.1 | hypothetical protein | - |
| OCX16_RS09355 | 1921300..1921641 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
| OCX16_RS09360 | 1921742..1922314 | + | 573 | WP_000414202.1 | hypothetical protein | - |
| OCX16_RS09365 | 1922512..1923140 | - | 629 | Protein_1843 | ImmA/IrrE family metallo-endopeptidase | - |
| OCX16_RS09370 | 1923443..1923619 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| OCX16_RS09375 | 1923630..1924013 | - | 384 | Protein_1845 | hypothetical protein | - |
| OCX16_RS09380 | 1924617..1924760 | - | 144 | WP_001549059.1 | transposase | - |
| OCX16_RS09385 | 1924963..1925058 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1925086..1925145 | - | 60 | - | - | Antitoxin |
| OCX16_RS09390 | 1925181..1925282 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| OCX16_RS09395 | 1925260..1925436 | - | 177 | Protein_1849 | transposase | - |
| OCX16_RS09400 | 1925630..1926007 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T39311 WP_001801861.1 NZ_AP024730:1924963-1925058 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T39311 NZ_AP024730:1924963-1925058 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT39311 NZ_AP024730:c1925145-1925086 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|