Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2496291..2496475 | Replicon | chromosome |
Accession | NZ_AP024728 | ||
Organism | Staphylococcus aureus strain 59553 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | OCX18_RS12475 | Protein ID | WP_000482647.1 |
Coordinates | 2496368..2496475 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2496291..2496351 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCX18_RS12460 | 2491765..2491932 | - | 168 | WP_001790576.1 | hypothetical protein | - |
OCX18_RS12465 | 2492163..2493896 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
OCX18_RS12470 | 2493921..2495684 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein | - |
- | 2496291..2496351 | + | 61 | - | - | Antitoxin |
OCX18_RS12475 | 2496368..2496475 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OCX18_RS12480 | 2496609..2496995 | - | 387 | WP_000779360.1 | flippase GtxA | - |
OCX18_RS12485 | 2497253..2498395 | + | 1143 | WP_001176871.1 | glycerate kinase | - |
OCX18_RS12490 | 2498455..2499114 | + | 660 | WP_000831301.1 | membrane protein | - |
OCX18_RS12495 | 2499296..2500507 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
OCX18_RS12500 | 2500630..2501103 | - | 474 | WP_000456497.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T39303 WP_000482647.1 NZ_AP024728:c2496475-2496368 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T39303 NZ_AP024728:c2496475-2496368 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT39303 NZ_AP024728:2496291-2496351 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|