Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1884014..1884196 | Replicon | chromosome |
| Accession | NZ_AP024728 | ||
| Organism | Staphylococcus aureus strain 59553 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | OCX18_RS09090 | Protein ID | WP_001801861.1 |
| Coordinates | 1884014..1884109 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1884137..1884196 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCX18_RS09055 | 1879684..1880310 | + | 627 | WP_000669017.1 | hypothetical protein | - |
| OCX18_RS09060 | 1880351..1880692 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
| OCX18_RS09065 | 1880793..1881365 | + | 573 | WP_000414202.1 | hypothetical protein | - |
| OCX18_RS09070 | 1881563..1882191 | - | 629 | Protein_1784 | ImmA/IrrE family metallo-endopeptidase | - |
| OCX18_RS09075 | 1882494..1882670 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| OCX18_RS09080 | 1882681..1883064 | - | 384 | Protein_1786 | hypothetical protein | - |
| OCX18_RS09085 | 1883668..1883811 | - | 144 | WP_001549059.1 | transposase | - |
| OCX18_RS09090 | 1884014..1884109 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1884137..1884196 | - | 60 | - | - | Antitoxin |
| OCX18_RS09095 | 1884232..1884333 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| OCX18_RS09100 | 1884311..1884487 | - | 177 | Protein_1790 | transposase | - |
| OCX18_RS09105 | 1884681..1885058 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T39291 WP_001801861.1 NZ_AP024728:1884014-1884109 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T39291 NZ_AP024728:1884014-1884109 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT39291 NZ_AP024728:c1884196-1884137 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|