Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2242263..2242479 | Replicon | chromosome |
Accession | NZ_AP024726 | ||
Organism | Staphylococcus aureus strain 59482 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OCX11_RS11260 | Protein ID | WP_001802298.1 |
Coordinates | 2242375..2242479 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2242263..2242318 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCX11_RS11230 | 2237486..2238311 | - | 826 | Protein_2172 | class I mannose-6-phosphate isomerase | - |
OCX11_RS11235 | 2238523..2239188 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
OCX11_RS11240 | 2239340..2239660 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OCX11_RS11245 | 2239662..2240642 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
OCX11_RS11250 | 2240908..2241999 | + | 1092 | WP_000495683.1 | hypothetical protein | - |
- | 2242263..2242318 | + | 56 | - | - | Antitoxin |
OCX11_RS11260 | 2242375..2242479 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
OCX11_RS11265 | 2243159..2243317 | + | 159 | WP_001792784.1 | hypothetical protein | - |
OCX11_RS11270 | 2243976..2244833 | - | 858 | WP_000370917.1 | HAD family hydrolase | - |
OCX11_RS11275 | 2244901..2245683 | - | 783 | WP_000908178.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T39284 WP_001802298.1 NZ_AP024726:c2242479-2242375 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T39284 NZ_AP024726:c2242479-2242375 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT39284 NZ_AP024726:2242263-2242318 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|