Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1909653..1909835 | Replicon | chromosome |
Accession | NZ_AP024726 | ||
Organism | Staphylococcus aureus strain 59482 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | OCX11_RS09340 | Protein ID | WP_001801861.1 |
Coordinates | 1909653..1909748 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1909776..1909835 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCX11_RS09305 | 1905323..1905949 | + | 627 | WP_000669017.1 | hypothetical protein | - |
OCX11_RS09310 | 1905990..1906331 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
OCX11_RS09315 | 1906432..1907004 | + | 573 | WP_000414202.1 | hypothetical protein | - |
OCX11_RS09320 | 1907202..1907830 | - | 629 | Protein_1834 | ImmA/IrrE family metallo-endopeptidase | - |
OCX11_RS09325 | 1908133..1908309 | - | 177 | WP_000375477.1 | hypothetical protein | - |
OCX11_RS09330 | 1908320..1908703 | - | 384 | Protein_1836 | hypothetical protein | - |
OCX11_RS09335 | 1909307..1909450 | - | 144 | WP_001549059.1 | transposase | - |
OCX11_RS09340 | 1909653..1909748 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1909776..1909835 | - | 60 | - | - | Antitoxin |
OCX11_RS09345 | 1909871..1909972 | + | 102 | WP_001791893.1 | hypothetical protein | - |
OCX11_RS09350 | 1909950..1910126 | - | 177 | Protein_1840 | transposase | - |
OCX11_RS09355 | 1910320..1910697 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1902972..1928355 | 25383 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T39276 WP_001801861.1 NZ_AP024726:1909653-1909748 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T39276 NZ_AP024726:1909653-1909748 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT39276 NZ_AP024726:c1909835-1909776 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|