Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 48550..48804 | Replicon | plasmid pFUJ80154-1 |
Accession | NZ_AP024688 | ||
Organism | Escherichia coli strain FUJ80154 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A1D7QA06 |
Locus tag | FJMB_RS25000 | Protein ID | WP_001367749.1 |
Coordinates | 48550..48699 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 48743..48804 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FJMB_RS24965 (43909) | 43909..44324 | - | 416 | Protein_57 | IS1 family transposase | - |
FJMB_RS24970 (44573) | 44573..44974 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
FJMB_RS24975 (44907) | 44907..45164 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
FJMB_RS24980 (45257) | 45257..45910 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
FJMB_RS24985 (46849) | 46849..47706 | - | 858 | WP_029702152.1 | incFII family plasmid replication initiator RepA | - |
FJMB_RS24990 (47699) | 47699..47773 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
FJMB_RS24995 (48009) | 48009..48266 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
FJMB_RS25000 (48550) | 48550..48699 | - | 150 | WP_001367749.1 | Hok/Gef family protein | Toxin |
- (48743) | 48743..48804 | + | 62 | NuclAT_0 | - | Antitoxin |
- (48743) | 48743..48804 | + | 62 | NuclAT_0 | - | Antitoxin |
- (48743) | 48743..48804 | + | 62 | NuclAT_0 | - | Antitoxin |
- (48743) | 48743..48804 | + | 62 | NuclAT_0 | - | Antitoxin |
FJMB_RS25005 (48943) | 48943..49371 | - | 429 | WP_029702151.1 | hypothetical protein | - |
FJMB_RS25010 (49584) | 49584..50153 | - | 570 | WP_029702150.1 | DUF2726 domain-containing protein | - |
FJMB_RS25015 (50305) | 50305..50931 | - | 627 | WP_029702149.1 | NYN domain-containing protein | - |
FJMB_RS25020 (51343) | 51343..51552 | - | 210 | WP_039023209.1 | hypothetical protein | - |
FJMB_RS25025 (51683) | 51683..52243 | - | 561 | WP_001567328.1 | fertility inhibition protein FinO | - |
FJMB_RS25030 (52298) | 52298..53044 | - | 747 | WP_052273601.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1B / blaCTX-M-15 / erm(B) / dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / mph(A) / aadA5 / tet(B) | - | 1..137114 | 137114 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5528.64 Da Isoelectric Point: 8.7678
>T39233 WP_001367749.1 NZ_AP024688:c48699-48550 [Escherichia coli]
MTKYALIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T39233 NZ_AP024688:c48699-48550 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGGTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGGTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT39233 NZ_AP024688:48743-48804 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|