Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1363020..1363240 Replicon chromosome
Accession NZ_AP024521
Organism Escherichia coli strain E189

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag LDO00_RS06620 Protein ID WP_000170954.1
Coordinates 1363020..1363127 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1363177..1363240 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LDO00_RS06595 (1358864) 1358864..1359946 + 1083 WP_000804726.1 peptide chain release factor 1 -
LDO00_RS06600 (1359946) 1359946..1360779 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
LDO00_RS06605 (1360776) 1360776..1361168 + 393 WP_000200378.1 invasion regulator SirB2 -
LDO00_RS06610 (1361172) 1361172..1361981 + 810 WP_001257044.1 invasion regulator SirB1 -
LDO00_RS06615 (1362017) 1362017..1362871 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LDO00_RS06620 (1363020) 1363020..1363127 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1363177) 1363177..1363240 + 64 NuclAT_45 - Antitoxin
- (1363177) 1363177..1363240 + 64 NuclAT_45 - Antitoxin
- (1363177) 1363177..1363240 + 64 NuclAT_45 - Antitoxin
- (1363177) 1363177..1363240 + 64 NuclAT_45 - Antitoxin
- (1363177) 1363177..1363240 + 64 NuclAT_48 - Antitoxin
- (1363177) 1363177..1363240 + 64 NuclAT_48 - Antitoxin
- (1363177) 1363177..1363240 + 64 NuclAT_48 - Antitoxin
- (1363177) 1363177..1363240 + 64 NuclAT_48 - Antitoxin
- (1363177) 1363177..1363240 + 64 NuclAT_51 - Antitoxin
- (1363177) 1363177..1363240 + 64 NuclAT_51 - Antitoxin
- (1363177) 1363177..1363240 + 64 NuclAT_51 - Antitoxin
- (1363177) 1363177..1363240 + 64 NuclAT_51 - Antitoxin
LDO00_RS06625 (1363555) 1363555..1363662 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1363715) 1363715..1363776 + 62 NuclAT_44 - -
- (1363715) 1363715..1363776 + 62 NuclAT_44 - -
- (1363715) 1363715..1363776 + 62 NuclAT_44 - -
- (1363715) 1363715..1363776 + 62 NuclAT_44 - -
- (1363715) 1363715..1363776 + 62 NuclAT_47 - -
- (1363715) 1363715..1363776 + 62 NuclAT_47 - -
- (1363715) 1363715..1363776 + 62 NuclAT_47 - -
- (1363715) 1363715..1363776 + 62 NuclAT_47 - -
- (1363715) 1363715..1363776 + 62 NuclAT_50 - -
- (1363715) 1363715..1363776 + 62 NuclAT_50 - -
- (1363715) 1363715..1363776 + 62 NuclAT_50 - -
- (1363715) 1363715..1363776 + 62 NuclAT_50 - -
- (1363715) 1363715..1363778 + 64 NuclAT_14 - -
- (1363715) 1363715..1363778 + 64 NuclAT_14 - -
- (1363715) 1363715..1363778 + 64 NuclAT_14 - -
- (1363715) 1363715..1363778 + 64 NuclAT_14 - -
- (1363715) 1363715..1363778 + 64 NuclAT_16 - -
- (1363715) 1363715..1363778 + 64 NuclAT_16 - -
- (1363715) 1363715..1363778 + 64 NuclAT_16 - -
- (1363715) 1363715..1363778 + 64 NuclAT_16 - -
- (1363715) 1363715..1363778 + 64 NuclAT_18 - -
- (1363715) 1363715..1363778 + 64 NuclAT_18 - -
- (1363715) 1363715..1363778 + 64 NuclAT_18 - -
- (1363715) 1363715..1363778 + 64 NuclAT_18 - -
- (1363715) 1363715..1363778 + 64 NuclAT_20 - -
- (1363715) 1363715..1363778 + 64 NuclAT_20 - -
- (1363715) 1363715..1363778 + 64 NuclAT_20 - -
- (1363715) 1363715..1363778 + 64 NuclAT_20 - -
- (1363715) 1363715..1363778 + 64 NuclAT_22 - -
- (1363715) 1363715..1363778 + 64 NuclAT_22 - -
- (1363715) 1363715..1363778 + 64 NuclAT_22 - -
- (1363715) 1363715..1363778 + 64 NuclAT_22 - -
- (1363715) 1363715..1363778 + 64 NuclAT_24 - -
- (1363715) 1363715..1363778 + 64 NuclAT_24 - -
- (1363715) 1363715..1363778 + 64 NuclAT_24 - -
- (1363715) 1363715..1363778 + 64 NuclAT_24 - -
LDO00_RS06630 (1364091) 1364091..1364198 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1364246) 1364246..1364311 + 66 NuclAT_43 - -
- (1364246) 1364246..1364311 + 66 NuclAT_43 - -
- (1364246) 1364246..1364311 + 66 NuclAT_43 - -
- (1364246) 1364246..1364311 + 66 NuclAT_43 - -
- (1364246) 1364246..1364311 + 66 NuclAT_46 - -
- (1364246) 1364246..1364311 + 66 NuclAT_46 - -
- (1364246) 1364246..1364311 + 66 NuclAT_46 - -
- (1364246) 1364246..1364311 + 66 NuclAT_46 - -
- (1364246) 1364246..1364311 + 66 NuclAT_49 - -
- (1364246) 1364246..1364311 + 66 NuclAT_49 - -
- (1364246) 1364246..1364311 + 66 NuclAT_49 - -
- (1364246) 1364246..1364311 + 66 NuclAT_49 - -
- (1364246) 1364246..1364313 + 68 NuclAT_13 - -
- (1364246) 1364246..1364313 + 68 NuclAT_13 - -
- (1364246) 1364246..1364313 + 68 NuclAT_13 - -
- (1364246) 1364246..1364313 + 68 NuclAT_13 - -
- (1364246) 1364246..1364313 + 68 NuclAT_15 - -
- (1364246) 1364246..1364313 + 68 NuclAT_15 - -
- (1364246) 1364246..1364313 + 68 NuclAT_15 - -
- (1364246) 1364246..1364313 + 68 NuclAT_15 - -
- (1364246) 1364246..1364313 + 68 NuclAT_17 - -
- (1364246) 1364246..1364313 + 68 NuclAT_17 - -
- (1364246) 1364246..1364313 + 68 NuclAT_17 - -
- (1364246) 1364246..1364313 + 68 NuclAT_17 - -
- (1364246) 1364246..1364313 + 68 NuclAT_19 - -
- (1364246) 1364246..1364313 + 68 NuclAT_19 - -
- (1364246) 1364246..1364313 + 68 NuclAT_19 - -
- (1364246) 1364246..1364313 + 68 NuclAT_19 - -
- (1364246) 1364246..1364313 + 68 NuclAT_21 - -
- (1364246) 1364246..1364313 + 68 NuclAT_21 - -
- (1364246) 1364246..1364313 + 68 NuclAT_21 - -
- (1364246) 1364246..1364313 + 68 NuclAT_21 - -
- (1364246) 1364246..1364313 + 68 NuclAT_23 - -
- (1364246) 1364246..1364313 + 68 NuclAT_23 - -
- (1364246) 1364246..1364313 + 68 NuclAT_23 - -
- (1364246) 1364246..1364313 + 68 NuclAT_23 - -
LDO00_RS06635 (1364603) 1364603..1365703 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
LDO00_RS06640 (1365973) 1365973..1366203 + 231 WP_001146442.1 putative cation transport regulator ChaB -
LDO00_RS06645 (1366361) 1366361..1367056 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
LDO00_RS06650 (1367100) 1367100..1367453 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T38585 WP_000170954.1 NZ_AP024521:c1363127-1363020 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T38585 NZ_AP024521:c1363127-1363020 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT38585 NZ_AP024521:1363177-1363240 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References