Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1364480..1364700 Replicon chromosome
Accession NZ_AP024518
Organism Escherichia coli strain E148

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag LDN98_RS06630 Protein ID WP_000170954.1
Coordinates 1364480..1364587 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1364637..1364700 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LDN98_RS06605 (1360324) 1360324..1361406 + 1083 WP_000804726.1 peptide chain release factor 1 -
LDN98_RS06610 (1361406) 1361406..1362239 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
LDN98_RS06615 (1362236) 1362236..1362628 + 393 WP_000200378.1 invasion regulator SirB2 -
LDN98_RS06620 (1362632) 1362632..1363441 + 810 WP_001257044.1 invasion regulator SirB1 -
LDN98_RS06625 (1363477) 1363477..1364331 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LDN98_RS06630 (1364480) 1364480..1364587 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1364637) 1364637..1364700 + 64 NuclAT_45 - Antitoxin
- (1364637) 1364637..1364700 + 64 NuclAT_45 - Antitoxin
- (1364637) 1364637..1364700 + 64 NuclAT_45 - Antitoxin
- (1364637) 1364637..1364700 + 64 NuclAT_45 - Antitoxin
- (1364637) 1364637..1364700 + 64 NuclAT_48 - Antitoxin
- (1364637) 1364637..1364700 + 64 NuclAT_48 - Antitoxin
- (1364637) 1364637..1364700 + 64 NuclAT_48 - Antitoxin
- (1364637) 1364637..1364700 + 64 NuclAT_48 - Antitoxin
- (1364637) 1364637..1364700 + 64 NuclAT_51 - Antitoxin
- (1364637) 1364637..1364700 + 64 NuclAT_51 - Antitoxin
- (1364637) 1364637..1364700 + 64 NuclAT_51 - Antitoxin
- (1364637) 1364637..1364700 + 64 NuclAT_51 - Antitoxin
LDN98_RS06635 (1365015) 1365015..1365122 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1365175) 1365175..1365236 + 62 NuclAT_44 - -
- (1365175) 1365175..1365236 + 62 NuclAT_44 - -
- (1365175) 1365175..1365236 + 62 NuclAT_44 - -
- (1365175) 1365175..1365236 + 62 NuclAT_44 - -
- (1365175) 1365175..1365236 + 62 NuclAT_47 - -
- (1365175) 1365175..1365236 + 62 NuclAT_47 - -
- (1365175) 1365175..1365236 + 62 NuclAT_47 - -
- (1365175) 1365175..1365236 + 62 NuclAT_47 - -
- (1365175) 1365175..1365236 + 62 NuclAT_50 - -
- (1365175) 1365175..1365236 + 62 NuclAT_50 - -
- (1365175) 1365175..1365236 + 62 NuclAT_50 - -
- (1365175) 1365175..1365236 + 62 NuclAT_50 - -
- (1365175) 1365175..1365238 + 64 NuclAT_14 - -
- (1365175) 1365175..1365238 + 64 NuclAT_14 - -
- (1365175) 1365175..1365238 + 64 NuclAT_14 - -
- (1365175) 1365175..1365238 + 64 NuclAT_14 - -
- (1365175) 1365175..1365238 + 64 NuclAT_16 - -
- (1365175) 1365175..1365238 + 64 NuclAT_16 - -
- (1365175) 1365175..1365238 + 64 NuclAT_16 - -
- (1365175) 1365175..1365238 + 64 NuclAT_16 - -
- (1365175) 1365175..1365238 + 64 NuclAT_18 - -
- (1365175) 1365175..1365238 + 64 NuclAT_18 - -
- (1365175) 1365175..1365238 + 64 NuclAT_18 - -
- (1365175) 1365175..1365238 + 64 NuclAT_18 - -
- (1365175) 1365175..1365238 + 64 NuclAT_20 - -
- (1365175) 1365175..1365238 + 64 NuclAT_20 - -
- (1365175) 1365175..1365238 + 64 NuclAT_20 - -
- (1365175) 1365175..1365238 + 64 NuclAT_20 - -
- (1365175) 1365175..1365238 + 64 NuclAT_22 - -
- (1365175) 1365175..1365238 + 64 NuclAT_22 - -
- (1365175) 1365175..1365238 + 64 NuclAT_22 - -
- (1365175) 1365175..1365238 + 64 NuclAT_22 - -
- (1365175) 1365175..1365238 + 64 NuclAT_24 - -
- (1365175) 1365175..1365238 + 64 NuclAT_24 - -
- (1365175) 1365175..1365238 + 64 NuclAT_24 - -
- (1365175) 1365175..1365238 + 64 NuclAT_24 - -
LDN98_RS06640 (1365551) 1365551..1365658 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1365706) 1365706..1365771 + 66 NuclAT_43 - -
- (1365706) 1365706..1365771 + 66 NuclAT_43 - -
- (1365706) 1365706..1365771 + 66 NuclAT_43 - -
- (1365706) 1365706..1365771 + 66 NuclAT_43 - -
- (1365706) 1365706..1365771 + 66 NuclAT_46 - -
- (1365706) 1365706..1365771 + 66 NuclAT_46 - -
- (1365706) 1365706..1365771 + 66 NuclAT_46 - -
- (1365706) 1365706..1365771 + 66 NuclAT_46 - -
- (1365706) 1365706..1365771 + 66 NuclAT_49 - -
- (1365706) 1365706..1365771 + 66 NuclAT_49 - -
- (1365706) 1365706..1365771 + 66 NuclAT_49 - -
- (1365706) 1365706..1365771 + 66 NuclAT_49 - -
- (1365706) 1365706..1365773 + 68 NuclAT_13 - -
- (1365706) 1365706..1365773 + 68 NuclAT_13 - -
- (1365706) 1365706..1365773 + 68 NuclAT_13 - -
- (1365706) 1365706..1365773 + 68 NuclAT_13 - -
- (1365706) 1365706..1365773 + 68 NuclAT_15 - -
- (1365706) 1365706..1365773 + 68 NuclAT_15 - -
- (1365706) 1365706..1365773 + 68 NuclAT_15 - -
- (1365706) 1365706..1365773 + 68 NuclAT_15 - -
- (1365706) 1365706..1365773 + 68 NuclAT_17 - -
- (1365706) 1365706..1365773 + 68 NuclAT_17 - -
- (1365706) 1365706..1365773 + 68 NuclAT_17 - -
- (1365706) 1365706..1365773 + 68 NuclAT_17 - -
- (1365706) 1365706..1365773 + 68 NuclAT_19 - -
- (1365706) 1365706..1365773 + 68 NuclAT_19 - -
- (1365706) 1365706..1365773 + 68 NuclAT_19 - -
- (1365706) 1365706..1365773 + 68 NuclAT_19 - -
- (1365706) 1365706..1365773 + 68 NuclAT_21 - -
- (1365706) 1365706..1365773 + 68 NuclAT_21 - -
- (1365706) 1365706..1365773 + 68 NuclAT_21 - -
- (1365706) 1365706..1365773 + 68 NuclAT_21 - -
- (1365706) 1365706..1365773 + 68 NuclAT_23 - -
- (1365706) 1365706..1365773 + 68 NuclAT_23 - -
- (1365706) 1365706..1365773 + 68 NuclAT_23 - -
- (1365706) 1365706..1365773 + 68 NuclAT_23 - -
LDN98_RS06645 (1366063) 1366063..1367163 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
LDN98_RS06650 (1367433) 1367433..1367663 + 231 WP_001146442.1 putative cation transport regulator ChaB -
LDN98_RS06655 (1367821) 1367821..1368516 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
LDN98_RS06660 (1368560) 1368560..1368913 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T38555 WP_000170954.1 NZ_AP024518:c1364587-1364480 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T38555 NZ_AP024518:c1364587-1364480 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT38555 NZ_AP024518:1364637-1364700 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References