Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2150289..2150506 | Replicon | chromosome |
Accession | NZ_AP024318 | ||
Organism | Staphylococcus aureus strain S36 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | K5606_RS10575 | Protein ID | WP_001802298.1 |
Coordinates | 2150402..2150506 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2150289..2150344 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K5606_RS10555 | 2146428..2147093 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
K5606_RS10560 | 2147245..2147565 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
K5606_RS10565 | 2147567..2148547 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
K5606_RS10570 | 2148813..2149904 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 2150289..2150344 | + | 56 | - | - | Antitoxin |
K5606_RS10575 | 2150402..2150506 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
K5606_RS10580 | 2151186..2151344 | + | 159 | WP_001792784.1 | hypothetical protein | - |
K5606_RS10585 | 2151780..2151872 | + | 93 | WP_000220902.1 | hypothetical protein | - |
K5606_RS10590 | 2152002..2152859 | - | 858 | WP_000370942.1 | HAD family hydrolase | - |
K5606_RS10595 | 2152927..2153709 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
K5606_RS10600 | 2153999..2154607 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T38364 WP_001802298.1 NZ_AP024318:c2150506-2150402 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T38364 NZ_AP024318:c2150506-2150402 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT38364 NZ_AP024318:2150289-2150344 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|