Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1976776..1977075 | Replicon | chromosome |
Accession | NZ_AP024318 | ||
Organism | Staphylococcus aureus strain S36 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | K5606_RS09620 | Protein ID | WP_011447039.1 |
Coordinates | 1976899..1977075 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1976776..1976831 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K5606_RS09580 | 1972107..1972367 | + | 261 | WP_001791826.1 | hypothetical protein | - |
K5606_RS09585 | 1972420..1972770 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
K5606_RS09590 | 1973455..1973904 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
K5606_RS09595 | 1973999..1974334 | - | 336 | Protein_1861 | SH3 domain-containing protein | - |
K5606_RS09600 | 1974984..1975475 | - | 492 | WP_000919350.1 | staphylokinase | - |
K5606_RS09605 | 1975666..1976421 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
K5606_RS09610 | 1976433..1976687 | - | 255 | WP_000611512.1 | phage holin | - |
K5606_RS09615 | 1976739..1976846 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1976768..1976907 | + | 140 | NuclAT_0 | - | - |
- | 1976768..1976907 | + | 140 | NuclAT_0 | - | - |
- | 1976768..1976907 | + | 140 | NuclAT_0 | - | - |
- | 1976768..1976907 | + | 140 | NuclAT_0 | - | - |
- | 1976776..1976831 | + | 56 | - | - | Antitoxin |
K5606_RS09620 | 1976899..1977075 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
K5606_RS09625 | 1977225..1977521 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
K5606_RS09630 | 1977579..1977866 | - | 288 | WP_001040261.1 | hypothetical protein | - |
K5606_RS09635 | 1977913..1978065 | - | 153 | WP_001153681.1 | hypothetical protein | - |
K5606_RS09640 | 1978055..1981840 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 1972420..2024841 | 52421 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T38359 WP_011447039.1 NZ_AP024318:c1977075-1976899 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T38359 NZ_AP024318:c1977075-1976899 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTACAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTACAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT38359 NZ_AP024318:1976776-1976831 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|