Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2182501..2182718 | Replicon | chromosome |
Accession | NZ_AP024315 | ||
Organism | Staphylococcus aureus strain BDH17 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | K5602_RS10710 | Protein ID | WP_001802298.1 |
Coordinates | 2182614..2182718 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2182501..2182556 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K5602_RS10690 | 2178640..2179305 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
K5602_RS10695 | 2179457..2179777 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
K5602_RS10700 | 2179779..2180759 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
K5602_RS10705 | 2181025..2182116 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 2182501..2182556 | + | 56 | - | - | Antitoxin |
K5602_RS10710 | 2182614..2182718 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
K5602_RS10715 | 2183398..2183556 | + | 159 | WP_001792784.1 | hypothetical protein | - |
K5602_RS10720 | 2183992..2184084 | + | 93 | WP_000220902.1 | hypothetical protein | - |
K5602_RS10725 | 2184214..2185071 | - | 858 | WP_000370942.1 | HAD family hydrolase | - |
K5602_RS10730 | 2185139..2185921 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
K5602_RS10735 | 2186211..2186819 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T38352 WP_001802298.1 NZ_AP024315:c2182718-2182614 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T38352 NZ_AP024315:c2182718-2182614 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT38352 NZ_AP024315:2182501-2182556 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|