Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2069836..2070135 | Replicon | chromosome |
| Accession | NZ_AP024313 | ||
| Organism | Staphylococcus aureus strain N1195 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | K5605_RS10180 | Protein ID | WP_011447039.1 |
| Coordinates | 2069959..2070135 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2069836..2069891 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K5605_RS10140 | 2065167..2065427 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| K5605_RS10145 | 2065480..2065830 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| K5605_RS10150 | 2066515..2066964 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| K5605_RS10155 | 2067059..2067394 | - | 336 | Protein_1975 | SH3 domain-containing protein | - |
| K5605_RS10160 | 2068044..2068535 | - | 492 | WP_000919350.1 | staphylokinase | - |
| K5605_RS10165 | 2068726..2069481 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| K5605_RS10170 | 2069493..2069747 | - | 255 | WP_000611512.1 | phage holin | - |
| K5605_RS10175 | 2069799..2069906 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2069828..2069967 | + | 140 | NuclAT_0 | - | - |
| - | 2069828..2069967 | + | 140 | NuclAT_0 | - | - |
| - | 2069828..2069967 | + | 140 | NuclAT_0 | - | - |
| - | 2069828..2069967 | + | 140 | NuclAT_0 | - | - |
| - | 2069836..2069891 | + | 56 | - | - | Antitoxin |
| K5605_RS10180 | 2069959..2070135 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| K5605_RS10185 | 2070285..2070581 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| K5605_RS10190 | 2070639..2070926 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| K5605_RS10195 | 2070973..2071125 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| K5605_RS10200 | 2071115..2074900 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2065480..2117901 | 52421 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T38335 WP_011447039.1 NZ_AP024313:c2070135-2069959 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T38335 NZ_AP024313:c2070135-2069959 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTACAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTACAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT38335 NZ_AP024313:2069836-2069891 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|