Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2247315..2247532 | Replicon | chromosome |
Accession | NZ_AP024311 | ||
Organism | Staphylococcus aureus strain THI2018-120 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | ST1232TP_RS11155 | Protein ID | WP_001802298.1 |
Coordinates | 2247428..2247532 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2247315..2247370 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ST1232TP_RS11135 | 2243454..2244119 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
ST1232TP_RS11140 | 2244271..2244591 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
ST1232TP_RS11145 | 2244593..2245573 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
ST1232TP_RS11150 | 2245839..2246930 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 2247315..2247370 | + | 56 | - | - | Antitoxin |
ST1232TP_RS11155 | 2247428..2247532 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
ST1232TP_RS11160 | 2248212..2248370 | + | 159 | WP_001792784.1 | hypothetical protein | - |
ST1232TP_RS11165 | 2248806..2248898 | + | 93 | WP_000220902.1 | hypothetical protein | - |
ST1232TP_RS11170 | 2249028..2249885 | - | 858 | WP_000370942.1 | HAD family hydrolase | - |
ST1232TP_RS11175 | 2249953..2250735 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
ST1232TP_RS11180 | 2251025..2251633 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T38328 WP_001802298.1 NZ_AP024311:c2247532-2247428 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T38328 NZ_AP024311:c2247532-2247428 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT38328 NZ_AP024311:2247315-2247370 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|