Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2072482..2072781 | Replicon | chromosome |
Accession | NZ_AP024311 | ||
Organism | Staphylococcus aureus strain THI2018-120 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | ST1232TP_RS10195 | Protein ID | WP_011447039.1 |
Coordinates | 2072605..2072781 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2072482..2072537 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ST1232TP_RS10155 | 2067813..2068073 | + | 261 | WP_001791826.1 | hypothetical protein | - |
ST1232TP_RS10160 | 2068126..2068476 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
ST1232TP_RS10165 | 2069161..2069610 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
ST1232TP_RS10170 | 2069705..2070040 | - | 336 | Protein_1978 | SH3 domain-containing protein | - |
ST1232TP_RS10175 | 2070690..2071181 | - | 492 | WP_000919350.1 | staphylokinase | - |
ST1232TP_RS10180 | 2071372..2072127 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
ST1232TP_RS10185 | 2072139..2072393 | - | 255 | WP_000611512.1 | phage holin | - |
ST1232TP_RS10190 | 2072445..2072552 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2072474..2072613 | + | 140 | NuclAT_0 | - | - |
- | 2072474..2072613 | + | 140 | NuclAT_0 | - | - |
- | 2072474..2072613 | + | 140 | NuclAT_0 | - | - |
- | 2072474..2072613 | + | 140 | NuclAT_0 | - | - |
- | 2072482..2072537 | + | 56 | - | - | Antitoxin |
ST1232TP_RS10195 | 2072605..2072781 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
ST1232TP_RS10200 | 2072931..2073227 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
ST1232TP_RS10205 | 2073285..2073572 | - | 288 | WP_001040261.1 | hypothetical protein | - |
ST1232TP_RS10210 | 2073619..2073771 | - | 153 | WP_001153681.1 | hypothetical protein | - |
ST1232TP_RS10215 | 2073761..2077546 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2068126..2124877 | 56751 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T38323 WP_011447039.1 NZ_AP024311:c2072781-2072605 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T38323 NZ_AP024311:c2072781-2072605 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTACAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTACAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT38323 NZ_AP024311:2072482-2072537 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|