Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 440877..441061 | Replicon | chromosome |
Accession | NZ_AP024203 | ||
Organism | Staphylococcus aureus strain SA23-1 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SA231_RS02345 | Protein ID | WP_000482647.1 |
Coordinates | 440954..441061 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 440877..440937 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SA231_RS02330 | 436463..436630 | - | 168 | WP_031785511.1 | hypothetical protein | - |
SA231_RS02335 | 436861..438594 | - | 1734 | WP_000488492.1 | ABC transporter ATP-binding protein | - |
SA231_RS02340 | 438643..440382 | - | 1740 | WP_001064831.1 | ABC transporter ATP-binding protein | - |
- | 440877..440937 | + | 61 | - | - | Antitoxin |
SA231_RS02345 | 440954..441061 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SA231_RS02350 | 441195..441581 | - | 387 | WP_000779354.1 | flippase GtxA | - |
SA231_RS02355 | 441849..442991 | + | 1143 | WP_001176860.1 | glycerate kinase | - |
SA231_RS02360 | 443051..443710 | + | 660 | WP_000831298.1 | membrane protein | - |
SA231_RS02365 | 443890..445101 | + | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
SA231_RS02370 | 445224..445697 | - | 474 | WP_000456491.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T38137 WP_000482647.1 NZ_AP024203:c441061-440954 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T38137 NZ_AP024203:c441061-440954 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT38137 NZ_AP024203:440877-440937 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|