Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2438041..2438225 | Replicon | chromosome |
Accession | NZ_AP024201 | ||
Organism | Staphylococcus argenteus strain Tokyo13069 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | JN167_RS11765 | Protein ID | WP_047527328.1 |
Coordinates | 2438118..2438225 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2438041..2438101 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN167_RS11755 | 2433895..2435628 | - | 1734 | WP_047431349.1 | ABC transporter ATP-binding protein/permease | - |
JN167_RS11760 | 2435653..2437416 | - | 1764 | WP_047527326.1 | ABC transporter ATP-binding protein/permease | - |
- | 2438041..2438101 | + | 61 | - | - | Antitoxin |
JN167_RS11765 | 2438118..2438225 | - | 108 | WP_047527328.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
JN167_RS11770 | 2438360..2438746 | - | 387 | WP_047527330.1 | flippase GtxA | - |
JN167_RS11775 | 2439013..2440155 | + | 1143 | WP_047527332.1 | glycerate kinase | - |
JN167_RS11780 | 2440214..2440873 | + | 660 | WP_000831306.1 | membrane protein | - |
JN167_RS11785 | 2441058..2442269 | + | 1212 | WP_047527334.1 | multidrug effflux MFS transporter | - |
JN167_RS11790 | 2442385..2442864 | - | 480 | WP_047527336.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T38132 WP_047527328.1 NZ_AP024201:c2438225-2438118 [Staphylococcus argenteus]
MFNLLIDIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T38132 NZ_AP024201:c2438225-2438118 [Staphylococcus argenteus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT38132 NZ_AP024201:2438041-2438101 [Staphylococcus argenteus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|