Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1828863..1829043 | Replicon | chromosome |
| Accession | NZ_AP024201 | ||
| Organism | Staphylococcus argenteus strain Tokyo13069 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | JN167_RS08480 | Protein ID | WP_001801861.1 |
| Coordinates | 1828863..1828958 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1828986..1829043 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN167_RS08450 | 1824892..1825518 | + | 627 | WP_047526911.1 | hypothetical protein | - |
| JN167_RS08455 | 1825559..1825900 | + | 342 | WP_047526913.1 | DUF3969 family protein | - |
| JN167_RS08460 | 1826001..1826573 | + | 573 | WP_047526915.1 | hypothetical protein | - |
| JN167_RS08465 | 1826771..1827328 | - | 558 | WP_047526917.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JN167_RS08470 | 1827513..1827959 | - | 447 | WP_031787841.1 | DUF1433 domain-containing protein | - |
| JN167_RS08475 | 1828081..1828338 | - | 258 | WP_047526919.1 | IS3 family transposase | - |
| JN167_RS08480 | 1828863..1828958 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1828986..1829043 | - | 58 | - | - | Antitoxin |
| JN167_RS08485 | 1829081..1829182 | + | 102 | WP_047526922.1 | hypothetical protein | - |
| JN167_RS08490 | 1829317..1829763 | - | 447 | WP_047526923.1 | DUF1433 domain-containing protein | - |
| JN167_RS08495 | 1829763..1830206 | - | 444 | WP_047526925.1 | DUF1433 domain-containing protein | - |
| JN167_RS08500 | 1830206..1830649 | - | 444 | WP_047526927.1 | DUF1433 domain-containing protein | - |
| JN167_RS08505 | 1831276..1832496 | - | 1221 | WP_047526928.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T38124 WP_001801861.1 NZ_AP024201:1828863-1828958 [Staphylococcus argenteus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T38124 NZ_AP024201:1828863-1828958 [Staphylococcus argenteus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT38124 NZ_AP024201:c1829043-1828986 [Staphylococcus argenteus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|