Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1828861..1829041 | Replicon | chromosome |
Accession | NZ_AP024200 | ||
Organism | Staphylococcus argenteus strain Tokyo13064 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | JN157_RS08485 | Protein ID | WP_001801861.1 |
Coordinates | 1828861..1828956 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1828984..1829041 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN157_RS08455 | 1824890..1825516 | + | 627 | WP_047526911.1 | hypothetical protein | - |
JN157_RS08460 | 1825557..1825898 | + | 342 | WP_047526913.1 | DUF3969 family protein | - |
JN157_RS08465 | 1825999..1826571 | + | 573 | WP_047526915.1 | hypothetical protein | - |
JN157_RS08470 | 1826769..1827326 | - | 558 | WP_047526917.1 | ImmA/IrrE family metallo-endopeptidase | - |
JN157_RS08475 | 1827511..1827957 | - | 447 | WP_031787841.1 | DUF1433 domain-containing protein | - |
JN157_RS08480 | 1828079..1828336 | - | 258 | WP_047526919.1 | IS3 family transposase | - |
JN157_RS08485 | 1828861..1828956 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1828984..1829041 | - | 58 | - | - | Antitoxin |
JN157_RS08490 | 1829079..1829180 | + | 102 | WP_047526922.1 | hypothetical protein | - |
JN157_RS08495 | 1829315..1829761 | - | 447 | WP_047526923.1 | DUF1433 domain-containing protein | - |
JN157_RS08500 | 1829761..1830204 | - | 444 | WP_047526925.1 | DUF1433 domain-containing protein | - |
JN157_RS08505 | 1830204..1830647 | - | 444 | WP_047526927.1 | DUF1433 domain-containing protein | - |
JN157_RS08510 | 1831274..1832494 | - | 1221 | WP_047526928.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T38110 WP_001801861.1 NZ_AP024200:1828861-1828956 [Staphylococcus argenteus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T38110 NZ_AP024200:1828861-1828956 [Staphylococcus argenteus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT38110 NZ_AP024200:c1829041-1828984 [Staphylococcus argenteus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|