Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2754343..2754563 Replicon chromosome
Accession NZ_AP024130
Organism Escherichia coli strain SI-NP020

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag FFK26_RS13490 Protein ID WP_000170965.1
Coordinates 2754456..2754563 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2754343..2754409 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FFK26_RS13465 2749623..2751017 - 1395 WP_000086212.1 inverse autotransporter invasin YchO -
FFK26_RS13470 2751202..2751555 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
FFK26_RS13475 2751599..2752294 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
FFK26_RS13480 2752452..2752682 - 231 WP_001146442.1 putative cation transport regulator ChaB -
FFK26_RS13485 2752951..2754051 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2754343..2754409 - 67 - - Antitoxin
FFK26_RS13490 2754456..2754563 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2754876..2754939 - 64 NuclAT_32 - -
- 2754876..2754939 - 64 NuclAT_32 - -
- 2754876..2754939 - 64 NuclAT_32 - -
- 2754876..2754939 - 64 NuclAT_32 - -
- 2754876..2754939 - 64 NuclAT_34 - -
- 2754876..2754939 - 64 NuclAT_34 - -
- 2754876..2754939 - 64 NuclAT_34 - -
- 2754876..2754939 - 64 NuclAT_34 - -
- 2754876..2754939 - 64 NuclAT_36 - -
- 2754876..2754939 - 64 NuclAT_36 - -
- 2754876..2754939 - 64 NuclAT_36 - -
- 2754876..2754939 - 64 NuclAT_36 - -
- 2754876..2754939 - 64 NuclAT_38 - -
- 2754876..2754939 - 64 NuclAT_38 - -
- 2754876..2754939 - 64 NuclAT_38 - -
- 2754876..2754939 - 64 NuclAT_38 - -
- 2754876..2754939 - 64 NuclAT_40 - -
- 2754876..2754939 - 64 NuclAT_40 - -
- 2754876..2754939 - 64 NuclAT_40 - -
- 2754876..2754939 - 64 NuclAT_40 - -
- 2754876..2754939 - 64 NuclAT_42 - -
- 2754876..2754939 - 64 NuclAT_42 - -
- 2754876..2754939 - 64 NuclAT_42 - -
- 2754876..2754939 - 64 NuclAT_42 - -
- 2754877..2754939 - 63 NuclAT_44 - -
- 2754877..2754939 - 63 NuclAT_44 - -
- 2754877..2754939 - 63 NuclAT_44 - -
- 2754877..2754939 - 63 NuclAT_44 - -
- 2754877..2754939 - 63 NuclAT_47 - -
- 2754877..2754939 - 63 NuclAT_47 - -
- 2754877..2754939 - 63 NuclAT_47 - -
- 2754877..2754939 - 63 NuclAT_47 - -
- 2754877..2754939 - 63 NuclAT_50 - -
- 2754877..2754939 - 63 NuclAT_50 - -
- 2754877..2754939 - 63 NuclAT_50 - -
- 2754877..2754939 - 63 NuclAT_50 - -
- 2754878..2754939 - 62 NuclAT_14 - -
- 2754878..2754939 - 62 NuclAT_14 - -
- 2754878..2754939 - 62 NuclAT_14 - -
- 2754878..2754939 - 62 NuclAT_14 - -
- 2754878..2754939 - 62 NuclAT_17 - -
- 2754878..2754939 - 62 NuclAT_17 - -
- 2754878..2754939 - 62 NuclAT_17 - -
- 2754878..2754939 - 62 NuclAT_17 - -
- 2754878..2754939 - 62 NuclAT_20 - -
- 2754878..2754939 - 62 NuclAT_20 - -
- 2754878..2754939 - 62 NuclAT_20 - -
- 2754878..2754939 - 62 NuclAT_20 - -
- 2754878..2754939 - 62 NuclAT_23 - -
- 2754878..2754939 - 62 NuclAT_23 - -
- 2754878..2754939 - 62 NuclAT_23 - -
- 2754878..2754939 - 62 NuclAT_23 - -
- 2754878..2754939 - 62 NuclAT_26 - -
- 2754878..2754939 - 62 NuclAT_26 - -
- 2754878..2754939 - 62 NuclAT_26 - -
- 2754878..2754939 - 62 NuclAT_26 - -
- 2754878..2754939 - 62 NuclAT_29 - -
- 2754878..2754939 - 62 NuclAT_29 - -
- 2754878..2754939 - 62 NuclAT_29 - -
- 2754878..2754939 - 62 NuclAT_29 - -
FFK26_RS13495 2754992..2755099 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2755413..2755479 - 67 NuclAT_43 - -
- 2755413..2755479 - 67 NuclAT_43 - -
- 2755413..2755479 - 67 NuclAT_43 - -
- 2755413..2755479 - 67 NuclAT_43 - -
- 2755413..2755479 - 67 NuclAT_46 - -
- 2755413..2755479 - 67 NuclAT_46 - -
- 2755413..2755479 - 67 NuclAT_46 - -
- 2755413..2755479 - 67 NuclAT_46 - -
- 2755413..2755479 - 67 NuclAT_49 - -
- 2755413..2755479 - 67 NuclAT_49 - -
- 2755413..2755479 - 67 NuclAT_49 - -
- 2755413..2755479 - 67 NuclAT_49 - -
- 2755414..2755477 - 64 NuclAT_15 - -
- 2755414..2755477 - 64 NuclAT_15 - -
- 2755414..2755477 - 64 NuclAT_15 - -
- 2755414..2755477 - 64 NuclAT_15 - -
- 2755414..2755477 - 64 NuclAT_18 - -
- 2755414..2755477 - 64 NuclAT_18 - -
- 2755414..2755477 - 64 NuclAT_18 - -
- 2755414..2755477 - 64 NuclAT_18 - -
- 2755414..2755477 - 64 NuclAT_21 - -
- 2755414..2755477 - 64 NuclAT_21 - -
- 2755414..2755477 - 64 NuclAT_21 - -
- 2755414..2755477 - 64 NuclAT_21 - -
- 2755414..2755477 - 64 NuclAT_24 - -
- 2755414..2755477 - 64 NuclAT_24 - -
- 2755414..2755477 - 64 NuclAT_24 - -
- 2755414..2755477 - 64 NuclAT_24 - -
- 2755414..2755477 - 64 NuclAT_27 - -
- 2755414..2755477 - 64 NuclAT_27 - -
- 2755414..2755477 - 64 NuclAT_27 - -
- 2755414..2755477 - 64 NuclAT_27 - -
- 2755414..2755477 - 64 NuclAT_30 - -
- 2755414..2755477 - 64 NuclAT_30 - -
- 2755414..2755477 - 64 NuclAT_30 - -
- 2755414..2755477 - 64 NuclAT_30 - -
FFK26_RS13500 2755527..2755634 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
FFK26_RS13505 2755783..2756637 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
FFK26_RS13510 2756673..2757482 - 810 WP_001257044.1 invasion regulator SirB1 -
FFK26_RS13515 2757486..2757878 - 393 WP_000200378.1 invasion regulator SirB2 -
FFK26_RS13520 2757875..2758708 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T38030 WP_000170965.1 NZ_AP024130:2754456-2754563 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T38030 NZ_AP024130:2754456-2754563 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT38030 NZ_AP024130:c2754409-2754343 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References