Detailed information of TA system TA038009

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 29471..29724
• Replicon: plasmid NS-NP030_P1
• Accession: NZ_AP024127
• Organism: Escherichia coli strain NS-NP030

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: FFJ14_RS25825
• Protein ID: WP_001312851.1
• Coordinates: 29575..29724 (+)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	29471..29530 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
FFJ14_RS25790 (24906)	24906..25367	+	462	WP_063113250.1	thermonuclease family protein	-
FFJ14_RS25795 (25413)	25413..25622	+	210	WP_063113249.1	hemolysin expression modulator Hha	-
FFJ14_RS25800 (25752)	25752..26132	+	381	WP_001171554.1	transposase	-
FFJ14_RS25805 (26129)	26129..26476	+	348	WP_000612591.1	IS66 family insertion sequence element accessory protein TnpB	-
FFJ14_RS25810 (26526)	26526..28064	+	1539	WP_137546056.1	IS66-like element ISEc8 family transposase	-
FFJ14_RS25815 (28111)	28111..28701	+	591	Protein_28	DUF2726 domain-containing protein	-
FFJ14_RS25820 (28855)	28855..29328	+	474	WP_063113281.1	hypothetical protein	-
- (29471)	29471..29530	-	60	NuclAT_0	-	Antitoxin
- (29471)	29471..29530	-	60	NuclAT_0	-	Antitoxin
- (29471)	29471..29530	-	60	NuclAT_0	-	Antitoxin
- (29471)	29471..29530	-	60	NuclAT_0	-	Antitoxin
FFJ14_RS25825 (29575)	29575..29724	+	150	WP_001312851.1	Hok/Gef family protein	Toxin
FFJ14_RS25830 (30008)	30008..30265	+	258	WP_021553168.1	replication regulatory protein RepA	-
FFJ14_RS25835 (30497)	30497..30574	+	78	WP_063113289.1	RepA leader peptide Tap	-
FFJ14_RS25840 (30567)	30567..31100	+	534	WP_063113282.1	plasmid replication initiator RepA	-
FFJ14_RS25845 (31090)	31090..32112	+	1023	WP_063113283.1	plasmid replication initiator RepA	-
FFJ14_RS25850 (32819)	32819..32977	+	159	WP_063113284.1	hypothetical protein	-
FFJ14_RS25855 (33032)	33032..33301	+	270	WP_000079930.1	type II toxin-antitoxin system antitoxin YacA	-
FFJ14_RS25860 (33319)	33319..33579	+	261	Protein_37	type II toxin-antitoxin system toxin YacB	-
FFJ14_RS27100 (33625)	33625..33723	+	99	Protein_38	3'-5' exonuclease	-
FFJ14_RS25865 (34032)	34032..34271	+	240	WP_042004543.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	hlyC / hlyA / hlyB / hlyD / cnf1	1..127587	127587

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T38009 WP_001312851.1 NZ_AP024127:29575-29724 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T38009 NZ_AP024127:29575-29724 [Escherichia coli]
ATGACGAAATATGCCCTTATAGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT38009 NZ_AP024127:c29530-29471 [Escherichia coli]
AACGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin