Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4868418..4868675 | Replicon | chromosome |
| Accession | NZ_AP024126 | ||
| Organism | Escherichia coli strain NS-NP030 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | FFJ14_RS23720 | Protein ID | WP_001135738.1 |
| Coordinates | 4868418..4868570 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 4868621..4868675 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FFJ14_RS23690 | 4864516..4865175 | + | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
| FFJ14_RS23695 | 4865279..4866253 | + | 975 | WP_000805027.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| FFJ14_RS23700 | 4866303..4867013 | - | 711 | WP_000190516.1 | DUF3053 domain-containing protein | - |
| FFJ14_RS23705 | 4867447..4867737 | + | 291 | WP_000455798.1 | HTH-type transcriptional regulator | - |
| FFJ14_RS23710 | 4868018..4868230 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| FFJ14_RS23715 | 4868370..4868429 | + | 60 | WP_212591412.1 | hypothetical protein | - |
| FFJ14_RS23720 | 4868418..4868570 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 4868621..4868675 | + | 55 | - | - | Antitoxin |
| FFJ14_RS23725 | 4868896..4870965 | - | 2070 | WP_001291774.1 | glycine--tRNA ligase subunit beta | - |
| FFJ14_RS23730 | 4870975..4871886 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| FFJ14_RS23735 | 4871981..4872280 | - | 300 | WP_000980111.1 | YsaB family lipoprotein | - |
| FFJ14_RS23740 | 4872455..4873450 | + | 996 | WP_063113396.1 | O-acetyltransferase WecH | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T38005 WP_001135738.1 NZ_AP024126:c4868570-4868418 [Escherichia coli]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
>T38005 NZ_AP024126:c4868570-4868418 [Escherichia coli]
ATGCCGCAGAAATATAGATTACTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
ATGCCGCAGAAATATAGATTACTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT38005 NZ_AP024126:4868621-4868675 [Escherichia coli]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|