Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 2167385..2167607 Replicon chromosome
Accession NZ_AP024126
Organism Escherichia coli strain NS-NP030

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag FFJ14_RS10585 Protein ID WP_000170965.1
Coordinates 2167385..2167492 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 2167540..2167607 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FFJ14_RS10555 (2163240) 2163240..2164073 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
FFJ14_RS10560 (2164070) 2164070..2164462 + 393 WP_000200378.1 invasion regulator SirB2 -
FFJ14_RS10565 (2164466) 2164466..2165275 + 810 WP_001257044.1 invasion regulator SirB1 -
FFJ14_RS10570 (2165311) 2165311..2166165 + 855 WP_063113747.1 3-deoxy-8-phosphooctulonate synthase -
FFJ14_RS10575 (2166314) 2166314..2166421 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2166471) 2166471..2166534 + 64 NuclAT_31 - -
- (2166471) 2166471..2166534 + 64 NuclAT_31 - -
- (2166471) 2166471..2166534 + 64 NuclAT_31 - -
- (2166471) 2166471..2166534 + 64 NuclAT_31 - -
- (2166471) 2166471..2166534 + 64 NuclAT_33 - -
- (2166471) 2166471..2166534 + 64 NuclAT_33 - -
- (2166471) 2166471..2166534 + 64 NuclAT_33 - -
- (2166471) 2166471..2166534 + 64 NuclAT_33 - -
- (2166471) 2166471..2166534 + 64 NuclAT_35 - -
- (2166471) 2166471..2166534 + 64 NuclAT_35 - -
- (2166471) 2166471..2166534 + 64 NuclAT_35 - -
- (2166471) 2166471..2166534 + 64 NuclAT_35 - -
- (2166469) 2166469..2166535 + 67 NuclAT_19 - -
- (2166469) 2166469..2166535 + 67 NuclAT_19 - -
- (2166469) 2166469..2166535 + 67 NuclAT_19 - -
- (2166469) 2166469..2166535 + 67 NuclAT_19 - -
- (2166469) 2166469..2166535 + 67 NuclAT_21 - -
- (2166469) 2166469..2166535 + 67 NuclAT_21 - -
- (2166469) 2166469..2166535 + 67 NuclAT_21 - -
- (2166469) 2166469..2166535 + 67 NuclAT_21 - -
- (2166469) 2166469..2166535 + 67 NuclAT_23 - -
- (2166469) 2166469..2166535 + 67 NuclAT_23 - -
- (2166469) 2166469..2166535 + 67 NuclAT_23 - -
- (2166469) 2166469..2166535 + 67 NuclAT_23 - -
- (2166469) 2166469..2166535 + 67 NuclAT_25 - -
- (2166469) 2166469..2166535 + 67 NuclAT_25 - -
- (2166469) 2166469..2166535 + 67 NuclAT_25 - -
- (2166469) 2166469..2166535 + 67 NuclAT_25 - -
- (2166469) 2166469..2166535 + 67 NuclAT_27 - -
- (2166469) 2166469..2166535 + 67 NuclAT_27 - -
- (2166469) 2166469..2166535 + 67 NuclAT_27 - -
- (2166469) 2166469..2166535 + 67 NuclAT_27 - -
- (2166469) 2166469..2166535 + 67 NuclAT_29 - -
- (2166469) 2166469..2166535 + 67 NuclAT_29 - -
- (2166469) 2166469..2166535 + 67 NuclAT_29 - -
- (2166469) 2166469..2166535 + 67 NuclAT_29 - -
FFJ14_RS10580 (2166849) 2166849..2166956 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2167009) 2167009..2167070 + 62 NuclAT_32 - -
- (2167009) 2167009..2167070 + 62 NuclAT_32 - -
- (2167009) 2167009..2167070 + 62 NuclAT_32 - -
- (2167009) 2167009..2167070 + 62 NuclAT_32 - -
- (2167009) 2167009..2167070 + 62 NuclAT_34 - -
- (2167009) 2167009..2167070 + 62 NuclAT_34 - -
- (2167009) 2167009..2167070 + 62 NuclAT_34 - -
- (2167009) 2167009..2167070 + 62 NuclAT_34 - -
- (2167009) 2167009..2167070 + 62 NuclAT_36 - -
- (2167009) 2167009..2167070 + 62 NuclAT_36 - -
- (2167009) 2167009..2167070 + 62 NuclAT_36 - -
- (2167009) 2167009..2167070 + 62 NuclAT_36 - -
- (2167009) 2167009..2167071 + 63 NuclAT_20 - -
- (2167009) 2167009..2167071 + 63 NuclAT_20 - -
- (2167009) 2167009..2167071 + 63 NuclAT_20 - -
- (2167009) 2167009..2167071 + 63 NuclAT_20 - -
- (2167009) 2167009..2167071 + 63 NuclAT_22 - -
- (2167009) 2167009..2167071 + 63 NuclAT_22 - -
- (2167009) 2167009..2167071 + 63 NuclAT_22 - -
- (2167009) 2167009..2167071 + 63 NuclAT_22 - -
- (2167009) 2167009..2167071 + 63 NuclAT_24 - -
- (2167009) 2167009..2167071 + 63 NuclAT_24 - -
- (2167009) 2167009..2167071 + 63 NuclAT_24 - -
- (2167009) 2167009..2167071 + 63 NuclAT_24 - -
- (2167009) 2167009..2167071 + 63 NuclAT_26 - -
- (2167009) 2167009..2167071 + 63 NuclAT_26 - -
- (2167009) 2167009..2167071 + 63 NuclAT_26 - -
- (2167009) 2167009..2167071 + 63 NuclAT_26 - -
- (2167009) 2167009..2167071 + 63 NuclAT_28 - -
- (2167009) 2167009..2167071 + 63 NuclAT_28 - -
- (2167009) 2167009..2167071 + 63 NuclAT_28 - -
- (2167009) 2167009..2167071 + 63 NuclAT_28 - -
- (2167009) 2167009..2167071 + 63 NuclAT_30 - -
- (2167009) 2167009..2167071 + 63 NuclAT_30 - -
- (2167009) 2167009..2167071 + 63 NuclAT_30 - -
- (2167009) 2167009..2167071 + 63 NuclAT_30 - -
FFJ14_RS10585 (2167385) 2167385..2167492 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2167540) 2167540..2167607 + 68 NuclAT_13 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_13 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_13 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_13 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_14 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_14 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_14 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_14 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_15 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_15 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_15 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_15 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_16 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_16 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_16 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_16 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_17 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_17 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_17 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_17 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_18 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_18 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_18 - Antitoxin
- (2167540) 2167540..2167607 + 68 NuclAT_18 - Antitoxin
FFJ14_RS10590 (2167897) 2167897..2168997 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
FFJ14_RS10595 (2169267) 2169267..2169497 + 231 WP_001146444.1 putative cation transport regulator ChaB -
FFJ14_RS10600 (2169655) 2169655..2170350 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
FFJ14_RS10605 (2170394) 2170394..2170747 - 354 WP_001169671.1 DsrE/F sulfur relay family protein YchN -
FFJ14_RS10610 (2170932) 2170932..2172326 + 1395 WP_000086212.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T37984 WP_000170965.1 NZ_AP024126:c2167492-2167385 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T37984 NZ_AP024126:c2167492-2167385 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT37984 NZ_AP024126:2167540-2167607 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References