Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2166314..2166535 | Replicon | chromosome |
Accession | NZ_AP024126 | ||
Organism | Escherichia coli strain NS-NP030 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1PGT3 |
Locus tag | FFJ14_RS10575 | Protein ID | WP_000170954.1 |
Coordinates | 2166314..2166421 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2166469..2166535 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FFJ14_RS10550 (2162158) | 2162158..2163240 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
FFJ14_RS10555 (2163240) | 2163240..2164073 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
FFJ14_RS10560 (2164070) | 2164070..2164462 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
FFJ14_RS10565 (2164466) | 2164466..2165275 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
FFJ14_RS10570 (2165311) | 2165311..2166165 | + | 855 | WP_063113747.1 | 3-deoxy-8-phosphooctulonate synthase | - |
FFJ14_RS10575 (2166314) | 2166314..2166421 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (2166471) | 2166471..2166534 | + | 64 | NuclAT_31 | - | - |
- (2166471) | 2166471..2166534 | + | 64 | NuclAT_31 | - | - |
- (2166471) | 2166471..2166534 | + | 64 | NuclAT_31 | - | - |
- (2166471) | 2166471..2166534 | + | 64 | NuclAT_31 | - | - |
- (2166471) | 2166471..2166534 | + | 64 | NuclAT_33 | - | - |
- (2166471) | 2166471..2166534 | + | 64 | NuclAT_33 | - | - |
- (2166471) | 2166471..2166534 | + | 64 | NuclAT_33 | - | - |
- (2166471) | 2166471..2166534 | + | 64 | NuclAT_33 | - | - |
- (2166471) | 2166471..2166534 | + | 64 | NuclAT_35 | - | - |
- (2166471) | 2166471..2166534 | + | 64 | NuclAT_35 | - | - |
- (2166471) | 2166471..2166534 | + | 64 | NuclAT_35 | - | - |
- (2166471) | 2166471..2166534 | + | 64 | NuclAT_35 | - | - |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_19 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_19 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_19 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_19 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_21 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_21 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_21 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_21 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_23 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_23 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_23 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_23 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_25 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_25 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_25 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_25 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_27 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_27 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_27 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_27 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_29 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_29 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_29 | - | Antitoxin |
- (2166469) | 2166469..2166535 | + | 67 | NuclAT_29 | - | Antitoxin |
FFJ14_RS10580 (2166849) | 2166849..2166956 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2167009) | 2167009..2167070 | + | 62 | NuclAT_32 | - | - |
- (2167009) | 2167009..2167070 | + | 62 | NuclAT_32 | - | - |
- (2167009) | 2167009..2167070 | + | 62 | NuclAT_32 | - | - |
- (2167009) | 2167009..2167070 | + | 62 | NuclAT_32 | - | - |
- (2167009) | 2167009..2167070 | + | 62 | NuclAT_34 | - | - |
- (2167009) | 2167009..2167070 | + | 62 | NuclAT_34 | - | - |
- (2167009) | 2167009..2167070 | + | 62 | NuclAT_34 | - | - |
- (2167009) | 2167009..2167070 | + | 62 | NuclAT_34 | - | - |
- (2167009) | 2167009..2167070 | + | 62 | NuclAT_36 | - | - |
- (2167009) | 2167009..2167070 | + | 62 | NuclAT_36 | - | - |
- (2167009) | 2167009..2167070 | + | 62 | NuclAT_36 | - | - |
- (2167009) | 2167009..2167070 | + | 62 | NuclAT_36 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_20 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_20 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_20 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_20 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_22 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_22 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_22 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_22 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_24 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_24 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_24 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_24 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_26 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_26 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_26 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_26 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_28 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_28 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_28 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_28 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_30 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_30 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_30 | - | - |
- (2167009) | 2167009..2167071 | + | 63 | NuclAT_30 | - | - |
FFJ14_RS10585 (2167385) | 2167385..2167492 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_13 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_13 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_13 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_13 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_14 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_14 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_14 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_14 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_15 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_15 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_15 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_15 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_16 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_16 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_16 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_16 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_17 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_17 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_17 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_17 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_18 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_18 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_18 | - | - |
- (2167540) | 2167540..2167607 | + | 68 | NuclAT_18 | - | - |
FFJ14_RS10590 (2167897) | 2167897..2168997 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
FFJ14_RS10595 (2169267) | 2169267..2169497 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
FFJ14_RS10600 (2169655) | 2169655..2170350 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
FFJ14_RS10605 (2170394) | 2170394..2170747 | - | 354 | WP_001169671.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T37980 WP_000170954.1 NZ_AP024126:c2166421-2166314 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T37980 NZ_AP024126:c2166421-2166314 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT37980 NZ_AP024126:2166469-2166535 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|