Detailed information of TA system TA037966

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 59989..60242
• Replicon: plasmid KS-NP019_P1
• Accession: NZ_AP024124
• Organism: Escherichia coli strain KS-NP019

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: FFG67_RS25405
• Protein ID: WP_001312851.1
• Coordinates: 59989..60138 (-)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	60183..60242 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
FFG67_RS25360 (55210)	55210..55461	-	252	WP_042004542.1	hypothetical protein	-
FFG67_RS25365 (55442)	55442..55681	-	240	WP_042004543.1	hypothetical protein	-
FFG67_RS26585 (55990)	55990..56088	-	99	Protein_49	3'-5' exonuclease	-
FFG67_RS25370 (56134)	56134..56394	-	261	Protein_50	type II toxin-antitoxin system toxin YacB	-
FFG67_RS25375 (56412)	56412..56681	-	270	WP_000079930.1	type II toxin-antitoxin system antitoxin YacA	-
FFG67_RS25380 (56736)	56736..56894	-	159	WP_063113284.1	hypothetical protein	-
FFG67_RS25385 (57601)	57601..58623	-	1023	WP_063113283.1	plasmid replication initiator RepA	-
FFG67_RS25390 (58613)	58613..59146	-	534	WP_063113282.1	plasmid replication initiator RepA	-
FFG67_RS26590 (59159)	59159..59345	-	187	Protein_55	protein CopA/IncA	-
FFG67_RS25400 (59448)	59448..59705	-	258	WP_021553168.1	replication regulatory protein RepA	-
FFG67_RS25405 (59989)	59989..60138	-	150	WP_001312851.1	Hok/Gef family protein	Toxin
- (60183)	60183..60242	+	60	NuclAT_0	-	Antitoxin
- (60183)	60183..60242	+	60	NuclAT_0	-	Antitoxin
- (60183)	60183..60242	+	60	NuclAT_0	-	Antitoxin
- (60183)	60183..60242	+	60	NuclAT_0	-	Antitoxin
FFG67_RS25410 (60385)	60385..60858	-	474	WP_063113281.1	hypothetical protein	-
FFG67_RS25415 (61012)	61012..61602	-	591	Protein_59	DUF2726 domain-containing protein	-
FFG67_RS25420 (61649)	61649..63187	-	1539	WP_137546056.1	IS66-like element ISEc8 family transposase	-
FFG67_RS25425 (63237)	63237..63584	-	348	WP_000612591.1	IS66 family insertion sequence element accessory protein TnpB	-
FFG67_RS25430 (63581)	63581..63961	-	381	WP_001171554.1	transposase	-
FFG67_RS25435 (64091)	64091..64300	-	210	WP_063113249.1	hemolysin expression modulator Hha	-
FFG67_RS25440 (64346)	64346..64807	-	462	WP_063113250.1	thermonuclease family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	cnf1 / hlyD / hlyB / hlyA / hlyC	1..127580	127580

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T37966 WP_001312851.1 NZ_AP024124:c60138-59989 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T37966 NZ_AP024124:c60138-59989 [Escherichia coli]
ATGACGAAATATGCCCTTATAGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT37966 NZ_AP024124:60183-60242 [Escherichia coli]
AACGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin