Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 454869..455090 Replicon chromosome
Accession NZ_AP024123
Organism Escherichia coli strain KS-NP019

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag FFG67_RS02165 Protein ID WP_000170954.1
Coordinates 454869..454976 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 455024..455090 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FFG67_RS02140 (450713) 450713..451795 + 1083 WP_000804726.1 peptide chain release factor 1 -
FFG67_RS02145 (451795) 451795..452628 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
FFG67_RS02150 (452625) 452625..453017 + 393 WP_000200378.1 invasion regulator SirB2 -
FFG67_RS02155 (453021) 453021..453830 + 810 WP_001257044.1 invasion regulator SirB1 -
FFG67_RS02160 (453866) 453866..454720 + 855 WP_063113747.1 3-deoxy-8-phosphooctulonate synthase -
FFG67_RS02165 (454869) 454869..454976 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (455026) 455026..455089 + 64 NuclAT_38 - -
- (455026) 455026..455089 + 64 NuclAT_38 - -
- (455026) 455026..455089 + 64 NuclAT_38 - -
- (455026) 455026..455089 + 64 NuclAT_38 - -
- (455026) 455026..455089 + 64 NuclAT_40 - -
- (455026) 455026..455089 + 64 NuclAT_40 - -
- (455026) 455026..455089 + 64 NuclAT_40 - -
- (455026) 455026..455089 + 64 NuclAT_40 - -
- (455026) 455026..455089 + 64 NuclAT_42 - -
- (455026) 455026..455089 + 64 NuclAT_42 - -
- (455026) 455026..455089 + 64 NuclAT_42 - -
- (455026) 455026..455089 + 64 NuclAT_42 - -
- (455024) 455024..455090 + 67 NuclAT_25 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_25 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_25 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_25 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_27 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_27 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_27 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_27 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_29 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_29 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_29 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_29 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_31 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_31 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_31 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_31 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_33 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_33 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_33 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_33 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_35 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_35 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_35 - Antitoxin
- (455024) 455024..455090 + 67 NuclAT_35 - Antitoxin
FFG67_RS02170 (455404) 455404..455511 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (455564) 455564..455625 + 62 NuclAT_37 - -
- (455564) 455564..455625 + 62 NuclAT_37 - -
- (455564) 455564..455625 + 62 NuclAT_37 - -
- (455564) 455564..455625 + 62 NuclAT_37 - -
- (455564) 455564..455625 + 62 NuclAT_39 - -
- (455564) 455564..455625 + 62 NuclAT_39 - -
- (455564) 455564..455625 + 62 NuclAT_39 - -
- (455564) 455564..455625 + 62 NuclAT_39 - -
- (455564) 455564..455625 + 62 NuclAT_41 - -
- (455564) 455564..455625 + 62 NuclAT_41 - -
- (455564) 455564..455625 + 62 NuclAT_41 - -
- (455564) 455564..455625 + 62 NuclAT_41 - -
- (455564) 455564..455626 + 63 NuclAT_26 - -
- (455564) 455564..455626 + 63 NuclAT_26 - -
- (455564) 455564..455626 + 63 NuclAT_26 - -
- (455564) 455564..455626 + 63 NuclAT_26 - -
- (455564) 455564..455626 + 63 NuclAT_28 - -
- (455564) 455564..455626 + 63 NuclAT_28 - -
- (455564) 455564..455626 + 63 NuclAT_28 - -
- (455564) 455564..455626 + 63 NuclAT_28 - -
- (455564) 455564..455626 + 63 NuclAT_30 - -
- (455564) 455564..455626 + 63 NuclAT_30 - -
- (455564) 455564..455626 + 63 NuclAT_30 - -
- (455564) 455564..455626 + 63 NuclAT_30 - -
- (455564) 455564..455626 + 63 NuclAT_32 - -
- (455564) 455564..455626 + 63 NuclAT_32 - -
- (455564) 455564..455626 + 63 NuclAT_32 - -
- (455564) 455564..455626 + 63 NuclAT_32 - -
- (455564) 455564..455626 + 63 NuclAT_34 - -
- (455564) 455564..455626 + 63 NuclAT_34 - -
- (455564) 455564..455626 + 63 NuclAT_34 - -
- (455564) 455564..455626 + 63 NuclAT_34 - -
- (455564) 455564..455626 + 63 NuclAT_36 - -
- (455564) 455564..455626 + 63 NuclAT_36 - -
- (455564) 455564..455626 + 63 NuclAT_36 - -
- (455564) 455564..455626 + 63 NuclAT_36 - -
- (455564) 455564..455627 + 64 NuclAT_14 - -
- (455564) 455564..455627 + 64 NuclAT_14 - -
- (455564) 455564..455627 + 64 NuclAT_14 - -
- (455564) 455564..455627 + 64 NuclAT_14 - -
- (455564) 455564..455627 + 64 NuclAT_16 - -
- (455564) 455564..455627 + 64 NuclAT_16 - -
- (455564) 455564..455627 + 64 NuclAT_16 - -
- (455564) 455564..455627 + 64 NuclAT_16 - -
- (455564) 455564..455627 + 64 NuclAT_18 - -
- (455564) 455564..455627 + 64 NuclAT_18 - -
- (455564) 455564..455627 + 64 NuclAT_18 - -
- (455564) 455564..455627 + 64 NuclAT_18 - -
- (455564) 455564..455627 + 64 NuclAT_20 - -
- (455564) 455564..455627 + 64 NuclAT_20 - -
- (455564) 455564..455627 + 64 NuclAT_20 - -
- (455564) 455564..455627 + 64 NuclAT_20 - -
- (455564) 455564..455627 + 64 NuclAT_22 - -
- (455564) 455564..455627 + 64 NuclAT_22 - -
- (455564) 455564..455627 + 64 NuclAT_22 - -
- (455564) 455564..455627 + 64 NuclAT_22 - -
- (455564) 455564..455627 + 64 NuclAT_24 - -
- (455564) 455564..455627 + 64 NuclAT_24 - -
- (455564) 455564..455627 + 64 NuclAT_24 - -
- (455564) 455564..455627 + 64 NuclAT_24 - -
FFG67_RS02175 (455940) 455940..456047 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (456095) 456095..456162 + 68 NuclAT_13 - -
- (456095) 456095..456162 + 68 NuclAT_13 - -
- (456095) 456095..456162 + 68 NuclAT_13 - -
- (456095) 456095..456162 + 68 NuclAT_13 - -
- (456095) 456095..456162 + 68 NuclAT_15 - -
- (456095) 456095..456162 + 68 NuclAT_15 - -
- (456095) 456095..456162 + 68 NuclAT_15 - -
- (456095) 456095..456162 + 68 NuclAT_15 - -
- (456095) 456095..456162 + 68 NuclAT_17 - -
- (456095) 456095..456162 + 68 NuclAT_17 - -
- (456095) 456095..456162 + 68 NuclAT_17 - -
- (456095) 456095..456162 + 68 NuclAT_17 - -
- (456095) 456095..456162 + 68 NuclAT_19 - -
- (456095) 456095..456162 + 68 NuclAT_19 - -
- (456095) 456095..456162 + 68 NuclAT_19 - -
- (456095) 456095..456162 + 68 NuclAT_19 - -
- (456095) 456095..456162 + 68 NuclAT_21 - -
- (456095) 456095..456162 + 68 NuclAT_21 - -
- (456095) 456095..456162 + 68 NuclAT_21 - -
- (456095) 456095..456162 + 68 NuclAT_21 - -
- (456095) 456095..456162 + 68 NuclAT_23 - -
- (456095) 456095..456162 + 68 NuclAT_23 - -
- (456095) 456095..456162 + 68 NuclAT_23 - -
- (456095) 456095..456162 + 68 NuclAT_23 - -
FFG67_RS02180 (456452) 456452..457552 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
FFG67_RS02185 (457822) 457822..458052 + 231 WP_001146444.1 putative cation transport regulator ChaB -
FFG67_RS02190 (458210) 458210..458905 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
FFG67_RS02195 (458949) 458949..459302 - 354 WP_001169671.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T37937 WP_000170954.1 NZ_AP024123:c454976-454869 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T37937 NZ_AP024123:c454976-454869 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT37937 NZ_AP024123:455024-455090 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References