Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 69773..70037 | Replicon | plasmid JML285_P1 |
| Accession | NZ_AP024115 | ||
| Organism | Escherichia coli strain JML285 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | FFF71_RS24335 | Protein ID | WP_001303307.1 |
| Coordinates | 69885..70037 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 69773..69835 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FFF71_RS24320 (65875) | 65875..66945 | - | 1071 | WP_000151592.1 | IncI1-type conjugal transfer protein TrbB | - |
| FFF71_RS24325 (66964) | 66964..68172 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (68352) | 68352..68412 | - | 61 | NuclAT_1 | - | - |
| - (68352) | 68352..68412 | - | 61 | NuclAT_1 | - | - |
| - (68352) | 68352..68412 | - | 61 | NuclAT_1 | - | - |
| - (68352) | 68352..68412 | - | 61 | NuclAT_1 | - | - |
| FFF71_RS24330 (68479) | 68479..69564 | - | 1086 | WP_000080543.1 | protein finQ | - |
| - (69773) | 69773..69835 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (69773) | 69773..69835 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (69773) | 69773..69835 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (69773) | 69773..69835 | - | 63 | NuclAT_0 | - | Antitoxin |
| FFF71_RS24335 (69885) | 69885..70037 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| FFF71_RS24340 (70109) | 70109..70360 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| - (70747) | 70747..70798 | - | 52 | NuclAT_2 | - | - |
| - (70747) | 70747..70798 | - | 52 | NuclAT_2 | - | - |
| - (70747) | 70747..70798 | - | 52 | NuclAT_2 | - | - |
| - (70747) | 70747..70798 | - | 52 | NuclAT_2 | - | - |
| FFF71_RS24345 (71284) | 71284..71460 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| FFF71_RS24350 (71669) | 71669..71878 | - | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| FFF71_RS24355 (71976) | 71976..72590 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| FFF71_RS24360 (72666) | 72666..74834 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3')-IIa / sul1 / qacE / aph(3'')-Ib / aph(6)-Id | - | 1..109993 | 109993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T37928 WP_001303307.1 NZ_AP024115:69885-70037 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T37928 NZ_AP024115:69885-70037 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT37928 NZ_AP024115:c69835-69773 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|