Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4125158..4125416 | Replicon | chromosome |
Accession | NZ_AP024114 | ||
Organism | Escherichia coli strain JML285 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | FFF71_RS19790 | Protein ID | WP_000809168.1 |
Coordinates | 4125264..4125416 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4125158..4125215 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FFF71_RS19770 | 4120205..4121536 | + | 1332 | Protein_3875 | fimbria/pilus outer membrane usher protein | - |
FFF71_RS19775 | 4121549..4122508 | + | 960 | WP_040089989.1 | hypothetical protein | - |
FFF71_RS19780 | 4122547..4123446 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
FFF71_RS19785 | 4123512..4124678 | - | 1167 | WP_000681368.1 | Na+/H+ antiporter NhaA | - |
- | 4125158..4125215 | - | 58 | - | - | Antitoxin |
FFF71_RS19790 | 4125264..4125416 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
FFF71_RS19795 | 4125520..4126650 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
FFF71_RS19800 | 4126739..4128655 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
FFF71_RS19805 | 4129032..4129436 | + | 405 | WP_000843559.1 | DUF2541 family protein | - |
FFF71_RS19810 | 4129462..4130175 | + | 714 | WP_001102383.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T37920 WP_000809168.1 NZ_AP024114:4125264-4125416 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T37920 NZ_AP024114:4125264-4125416 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT37920 NZ_AP024114:c4125215-4125158 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATAGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATAGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|