Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 52831..53100 | Replicon | plasmid pM941-NDM5 |
Accession | NZ_AP023454 | ||
Organism | Klebsiella pneumoniae strain M941 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | JLF44_RS26730 | Protein ID | WP_001312861.1 |
Coordinates | 52942..53100 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 52831..52896 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLF44_RS26705 | 48541..49068 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
JLF44_RS26710 | 49126..49359 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
JLF44_RS26715 | 49420..51443 | + | 2024 | Protein_61 | ParB/RepB/Spo0J family partition protein | - |
JLF44_RS26720 | 51512..51946 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
JLF44_RS26725 | 51943..52662 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 52674..52898 | + | 225 | NuclAT_0 | - | - |
- | 52674..52898 | + | 225 | NuclAT_0 | - | - |
- | 52674..52898 | + | 225 | NuclAT_0 | - | - |
- | 52674..52898 | + | 225 | NuclAT_0 | - | - |
- | 52831..52896 | + | 66 | - | - | Antitoxin |
JLF44_RS26730 | 52942..53100 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
JLF44_RS26735 | 53338..53715 | - | 378 | Protein_65 | hypothetical protein | - |
JLF44_RS26740 | 54015..54311 | + | 297 | WP_001272251.1 | hypothetical protein | - |
JLF44_RS26745 | 54422..55243 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
JLF44_RS26750 | 55540..56142 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
JLF44_RS26755 | 56465..56848 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
JLF44_RS26760 | 57042..57713 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
JLF44_RS26765 | 57850..58077 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(B) / mph(A) / blaTEM-1B / rmtB / blaNDM-5 / sul1 / qacE / aadA2 / dfrA12 | - | 1..93470 | 93470 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T37819 WP_001312861.1 NZ_AP023454:52942-53100 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T37819 NZ_AP023454:52942-53100 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT37819 NZ_AP023454:52831-52896 [Klebsiella pneumoniae]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|