Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 53966..54235 | Replicon | plasmid pM71901 |
| Accession | NZ_AP023434 | ||
| Organism | Escherichia coli strain M719 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M2043_RS23800 | Protein ID | WP_001372321.1 |
| Coordinates | 54110..54235 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 53966..54031 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2043_RS23765 | 49676..50203 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| M2043_RS23770 | 50261..50494 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| M2043_RS23775 | 50555..52578 | + | 2024 | Protein_65 | ParB/RepB/Spo0J family partition protein | - |
| M2043_RS23780 | 52647..53081 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| M2043_RS23785 | 53078..53840 | + | 763 | Protein_67 | plasmid SOS inhibition protein A | - |
| - | 53809..54033 | + | 225 | NuclAT_0 | - | - |
| - | 53809..54033 | + | 225 | NuclAT_0 | - | - |
| - | 53809..54033 | + | 225 | NuclAT_0 | - | - |
| - | 53809..54033 | + | 225 | NuclAT_0 | - | - |
| M2043_RS23790 | 53818..53997 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 53966..54031 | + | 66 | - | - | Antitoxin |
| M2043_RS23795 | 54019..54168 | + | 150 | Protein_69 | plasmid maintenance protein Mok | - |
| M2043_RS23800 | 54110..54235 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M2043_RS23805 | 54554..54850 | - | 297 | Protein_71 | hypothetical protein | - |
| M2043_RS23810 | 55150..55446 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| M2043_RS23815 | 55557..56378 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| M2043_RS23820 | 56675..57277 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| M2043_RS23825 | 57600..57983 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M2043_RS23830 | 58177..58848 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| M2043_RS23835 | 58985..59212 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T37744 WP_001372321.1 NZ_AP023434:54110-54235 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T37744 NZ_AP023434:54110-54235 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT37744 NZ_AP023434:53966-54031 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|