Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2630953..2631173 Replicon chromosome
Accession NZ_AP023427
Organism Escherichia coli strain HUE1

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag IF662_RS12610 Protein ID WP_000170965.1
Coordinates 2631066..2631173 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2630953..2631019 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IF662_RS12585 2626231..2627625 - 1395 WP_063502011.1 inverse autotransporter invasin YchO -
IF662_RS12590 2627811..2628164 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
IF662_RS12595 2628208..2628903 - 696 WP_190300537.1 glutathione-specific gamma-glutamylcyclotransferase -
IF662_RS12600 2629061..2629291 - 231 WP_001146444.1 putative cation transport regulator ChaB -
IF662_RS12605 2629561..2630661 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2630953..2631019 - 67 - - Antitoxin
IF662_RS12610 2631066..2631173 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2631486..2631553 - 68 NuclAT_45 - -
- 2631486..2631553 - 68 NuclAT_45 - -
- 2631486..2631553 - 68 NuclAT_45 - -
- 2631486..2631553 - 68 NuclAT_45 - -
- 2631487..2631552 - 66 NuclAT_14 - -
- 2631487..2631552 - 66 NuclAT_14 - -
- 2631487..2631552 - 66 NuclAT_14 - -
- 2631487..2631552 - 66 NuclAT_14 - -
- 2631487..2631552 - 66 NuclAT_16 - -
- 2631487..2631552 - 66 NuclAT_16 - -
- 2631487..2631552 - 66 NuclAT_16 - -
- 2631487..2631552 - 66 NuclAT_16 - -
- 2631487..2631552 - 66 NuclAT_18 - -
- 2631487..2631552 - 66 NuclAT_18 - -
- 2631487..2631552 - 66 NuclAT_18 - -
- 2631487..2631552 - 66 NuclAT_18 - -
- 2631487..2631552 - 66 NuclAT_20 - -
- 2631487..2631552 - 66 NuclAT_20 - -
- 2631487..2631552 - 66 NuclAT_20 - -
- 2631487..2631552 - 66 NuclAT_20 - -
- 2631487..2631552 - 66 NuclAT_22 - -
- 2631487..2631552 - 66 NuclAT_22 - -
- 2631487..2631552 - 66 NuclAT_22 - -
- 2631487..2631552 - 66 NuclAT_22 - -
- 2631487..2631552 - 66 NuclAT_24 - -
- 2631487..2631552 - 66 NuclAT_24 - -
- 2631487..2631552 - 66 NuclAT_24 - -
- 2631487..2631552 - 66 NuclAT_24 - -
- 2631488..2631553 - 66 NuclAT_26 - -
- 2631488..2631553 - 66 NuclAT_26 - -
- 2631488..2631553 - 66 NuclAT_26 - -
- 2631488..2631553 - 66 NuclAT_26 - -
- 2631488..2631553 - 66 NuclAT_29 - -
- 2631488..2631553 - 66 NuclAT_29 - -
- 2631488..2631553 - 66 NuclAT_29 - -
- 2631488..2631553 - 66 NuclAT_29 - -
- 2631488..2631553 - 66 NuclAT_32 - -
- 2631488..2631553 - 66 NuclAT_32 - -
- 2631488..2631553 - 66 NuclAT_32 - -
- 2631488..2631553 - 66 NuclAT_32 - -
- 2631488..2631553 - 66 NuclAT_35 - -
- 2631488..2631553 - 66 NuclAT_35 - -
- 2631488..2631553 - 66 NuclAT_35 - -
- 2631488..2631553 - 66 NuclAT_35 - -
- 2631488..2631553 - 66 NuclAT_39 - -
- 2631488..2631553 - 66 NuclAT_39 - -
- 2631488..2631553 - 66 NuclAT_39 - -
- 2631488..2631553 - 66 NuclAT_39 - -
- 2631488..2631553 - 66 NuclAT_42 - -
- 2631488..2631553 - 66 NuclAT_42 - -
- 2631488..2631553 - 66 NuclAT_42 - -
- 2631488..2631553 - 66 NuclAT_42 - -
IF662_RS12615 2631601..2631708 + 108 WP_000170963.1 small toxic polypeptide LdrB -
- 2632021..2632086 - 66 NuclAT_47 - -
- 2632021..2632086 - 66 NuclAT_47 - -
- 2632021..2632086 - 66 NuclAT_47 - -
- 2632021..2632086 - 66 NuclAT_47 - -
- 2632022..2632088 - 67 NuclAT_13 - -
- 2632022..2632088 - 67 NuclAT_13 - -
- 2632022..2632088 - 67 NuclAT_13 - -
- 2632022..2632088 - 67 NuclAT_13 - -
- 2632022..2632088 - 67 NuclAT_15 - -
- 2632022..2632088 - 67 NuclAT_15 - -
- 2632022..2632088 - 67 NuclAT_15 - -
- 2632022..2632088 - 67 NuclAT_15 - -
- 2632022..2632088 - 67 NuclAT_17 - -
- 2632022..2632088 - 67 NuclAT_17 - -
- 2632022..2632088 - 67 NuclAT_17 - -
- 2632022..2632088 - 67 NuclAT_17 - -
- 2632022..2632088 - 67 NuclAT_19 - -
- 2632022..2632088 - 67 NuclAT_19 - -
- 2632022..2632088 - 67 NuclAT_19 - -
- 2632022..2632088 - 67 NuclAT_19 - -
- 2632022..2632088 - 67 NuclAT_21 - -
- 2632022..2632088 - 67 NuclAT_21 - -
- 2632022..2632088 - 67 NuclAT_21 - -
- 2632022..2632088 - 67 NuclAT_21 - -
- 2632022..2632088 - 67 NuclAT_23 - -
- 2632022..2632088 - 67 NuclAT_23 - -
- 2632022..2632088 - 67 NuclAT_23 - -
- 2632022..2632088 - 67 NuclAT_23 - -
- 2632023..2632086 - 64 NuclAT_28 - -
- 2632023..2632086 - 64 NuclAT_28 - -
- 2632023..2632086 - 64 NuclAT_28 - -
- 2632023..2632086 - 64 NuclAT_28 - -
- 2632023..2632086 - 64 NuclAT_31 - -
- 2632023..2632086 - 64 NuclAT_31 - -
- 2632023..2632086 - 64 NuclAT_31 - -
- 2632023..2632086 - 64 NuclAT_31 - -
- 2632023..2632086 - 64 NuclAT_34 - -
- 2632023..2632086 - 64 NuclAT_34 - -
- 2632023..2632086 - 64 NuclAT_34 - -
- 2632023..2632086 - 64 NuclAT_34 - -
- 2632023..2632086 - 64 NuclAT_37 - -
- 2632023..2632086 - 64 NuclAT_37 - -
- 2632023..2632086 - 64 NuclAT_37 - -
- 2632023..2632086 - 64 NuclAT_37 - -
- 2632023..2632086 - 64 NuclAT_41 - -
- 2632023..2632086 - 64 NuclAT_41 - -
- 2632023..2632086 - 64 NuclAT_41 - -
- 2632023..2632086 - 64 NuclAT_41 - -
- 2632023..2632086 - 64 NuclAT_44 - -
- 2632023..2632086 - 64 NuclAT_44 - -
- 2632023..2632086 - 64 NuclAT_44 - -
- 2632023..2632086 - 64 NuclAT_44 - -
IF662_RS12620 2632136..2632243 + 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein -
IF662_RS12625 2632390..2633244 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
IF662_RS12630 2633280..2634089 - 810 WP_001257044.1 invasion regulator SirB1 -
IF662_RS12635 2634093..2634485 - 393 WP_063502054.1 invasion regulator SirB2 -
IF662_RS12640 2634482..2635315 - 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T37714 WP_000170965.1 NZ_AP023427:2631066-2631173 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T37714 NZ_AP023427:2631066-2631173 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT37714 NZ_AP023427:c2631019-2630953 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGGTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References