Detailed information of TA system TA037523

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 63387..63656
• Replicon: plasmid L-4605 strain 4[5]12:i:-
• Accession: NZ_AP023314
• Organism: Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain L-4605

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: K5670_RS24220
• Protein ID: WP_001372321.1
• Coordinates: 63531..63656 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	63387..63452 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
K5670_RS24630	58461..58688	+	228	WP_071961421.1	hypothetical protein	-
K5670_RS24190	58929..59135	+	207	WP_000275853.1	hypothetical protein	-
K5670_RS24195	59161..59700	+	540	WP_032332913.1	single-stranded DNA-binding protein	-
K5670_RS24200	59757..59990	+	234	WP_000005987.1	DUF905 family protein	-
K5670_RS24205	60055..62013	+	1959	WP_039000998.1	ParB/RepB/Spo0J family partition protein	-
K5670_RS24210	62068..62502	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
K5670_RS24215	62499..63218	+	720	WP_001276232.1	plasmid SOS inhibition protein A	-
-	63230..63454	+	225	NuclAT_0	-	-
-	63230..63454	+	225	NuclAT_0	-	-
-	63230..63454	+	225	NuclAT_0	-	-
-	63230..63454	+	225	NuclAT_0	-	-
-	63387..63452	+	66	-	-	Antitoxin
K5670_RS24635	63440..63589	+	150	Protein_82	plasmid maintenance protein Mok	-
K5670_RS24220	63531..63656	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
K5670_RS24640	63876..64106	+	231	WP_001426396.1	hypothetical protein	-
K5670_RS24645	64104..64277	-	174	Protein_85	hypothetical protein	-
K5670_RS24650	64347..64553	+	207	WP_000547968.1	hypothetical protein	-
K5670_RS24225	64578..64865	+	288	WP_000107535.1	hypothetical protein	-
K5670_RS24230	64987..65808	+	822	WP_072795862.1	DUF932 domain-containing protein	-
K5670_RS24235	66105..66707	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
K5670_RS24240	67028..67411	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
K5670_RS24245	67598..68287	+	690	WP_039002187.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	mcr-3.1 / aac(3)-IId / blaTEM-1B / sul3	-	1..99131	99131

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T37523 WP_001372321.1 NZ_AP023314:63531-63656 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T37523 NZ_AP023314:63531-63656 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT37523 NZ_AP023314:63387-63452 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin