Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 63387..63656 | Replicon | plasmid L-4605 strain 4[5]12:i:- |
| Accession | NZ_AP023314 | ||
| Organism | Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain L-4605 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | K5670_RS24220 | Protein ID | WP_001372321.1 |
| Coordinates | 63531..63656 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 63387..63452 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K5670_RS24630 | 58461..58688 | + | 228 | WP_071961421.1 | hypothetical protein | - |
| K5670_RS24190 | 58929..59135 | + | 207 | WP_000275853.1 | hypothetical protein | - |
| K5670_RS24195 | 59161..59700 | + | 540 | WP_032332913.1 | single-stranded DNA-binding protein | - |
| K5670_RS24200 | 59757..59990 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
| K5670_RS24205 | 60055..62013 | + | 1959 | WP_039000998.1 | ParB/RepB/Spo0J family partition protein | - |
| K5670_RS24210 | 62068..62502 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| K5670_RS24215 | 62499..63218 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| - | 63230..63454 | + | 225 | NuclAT_0 | - | - |
| - | 63230..63454 | + | 225 | NuclAT_0 | - | - |
| - | 63230..63454 | + | 225 | NuclAT_0 | - | - |
| - | 63230..63454 | + | 225 | NuclAT_0 | - | - |
| - | 63387..63452 | + | 66 | - | - | Antitoxin |
| K5670_RS24635 | 63440..63589 | + | 150 | Protein_82 | plasmid maintenance protein Mok | - |
| K5670_RS24220 | 63531..63656 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| K5670_RS24640 | 63876..64106 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| K5670_RS24645 | 64104..64277 | - | 174 | Protein_85 | hypothetical protein | - |
| K5670_RS24650 | 64347..64553 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| K5670_RS24225 | 64578..64865 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| K5670_RS24230 | 64987..65808 | + | 822 | WP_072795862.1 | DUF932 domain-containing protein | - |
| K5670_RS24235 | 66105..66707 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| K5670_RS24240 | 67028..67411 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| K5670_RS24245 | 67598..68287 | + | 690 | WP_039002187.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mcr-3.1 / aac(3)-IId / blaTEM-1B / sul3 | - | 1..99131 | 99131 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T37523 WP_001372321.1 NZ_AP023314:63531-63656 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T37523 NZ_AP023314:63531-63656 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT37523 NZ_AP023314:63387-63452 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|