Detailed information of TA system TA037444

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 91394..91820
• Replicon: plasmid L-4567 strain 4[5]12:i:-
• Accession: NZ_AP023307
• Organism: Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain L-4567

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: K5646_RS24405
• Protein ID: WP_001372321.1
• Coordinates: 91394..91519 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	91596..91820 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
K5646_RS24380 (86762)	86762..87451	-	690	WP_039002187.1	conjugal transfer transcriptional regulator TraJ	-
K5646_RS24385 (87638)	87638..88021	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
K5646_RS24390 (88342)	88342..88944	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
K5646_RS24395 (89241)	89241..90062	-	822	WP_072795862.1	DUF932 domain-containing protein	-
K5646_RS24400 (90185)	90185..90472	-	288	WP_000107535.1	hypothetical protein	-
K5646_RS24895 (90497)	90497..90703	-	207	WP_000547968.1	hypothetical protein	-
K5646_RS24900 (90773)	90773..90946	+	174	Protein_107	hypothetical protein	-
K5646_RS24905 (90944)	90944..91174	-	231	WP_001426396.1	hypothetical protein	-
K5646_RS24405 (91394)	91394..91519	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
K5646_RS24910 (91461)	91461..91610	-	150	Protein_110	plasmid maintenance protein Mok	-
- (91596)	91596..91820	-	225	NuclAT_0	-	Antitoxin
- (91596)	91596..91820	-	225	NuclAT_0	-	Antitoxin
- (91596)	91596..91820	-	225	NuclAT_0	-	Antitoxin
- (91596)	91596..91820	-	225	NuclAT_0	-	Antitoxin
K5646_RS24410 (91832)	91832..92551	-	720	WP_001276232.1	plasmid SOS inhibition protein A	-
K5646_RS24415 (92548)	92548..92982	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
K5646_RS24420 (93037)	93037..94995	-	1959	WP_039000998.1	ParB/RepB/Spo0J family partition protein	-
K5646_RS24425 (95060)	95060..95293	-	234	WP_000005987.1	DUF905 family protein	-
K5646_RS24430 (95350)	95350..95889	-	540	WP_032332913.1	single-stranded DNA-binding protein	-
K5646_RS24435 (95915)	95915..96121	-	207	WP_000275853.1	hypothetical protein	-
K5646_RS24915 (96362)	96362..96589	-	228	WP_071961421.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(M) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / floR / sul2 / tet(A) / sul3 / blaTEM-1B / aac(3)-IId / mcr-3.1	-	1..131843	131843

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T37444 WP_001372321.1 NZ_AP023307:c91519-91394 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T37444 NZ_AP023307:c91519-91394 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 225 bp

>AT37444 NZ_AP023307:c91820-91596 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin