Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 91394..91820 | Replicon | plasmid L-4567 strain 4[5]12:i:- |
| Accession | NZ_AP023307 | ||
| Organism | Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain L-4567 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | K5646_RS24405 | Protein ID | WP_001372321.1 |
| Coordinates | 91394..91519 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 91596..91820 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K5646_RS24380 (86762) | 86762..87451 | - | 690 | WP_039002187.1 | conjugal transfer transcriptional regulator TraJ | - |
| K5646_RS24385 (87638) | 87638..88021 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| K5646_RS24390 (88342) | 88342..88944 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| K5646_RS24395 (89241) | 89241..90062 | - | 822 | WP_072795862.1 | DUF932 domain-containing protein | - |
| K5646_RS24400 (90185) | 90185..90472 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| K5646_RS24895 (90497) | 90497..90703 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| K5646_RS24900 (90773) | 90773..90946 | + | 174 | Protein_107 | hypothetical protein | - |
| K5646_RS24905 (90944) | 90944..91174 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| K5646_RS24405 (91394) | 91394..91519 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| K5646_RS24910 (91461) | 91461..91610 | - | 150 | Protein_110 | plasmid maintenance protein Mok | - |
| - (91596) | 91596..91820 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (91596) | 91596..91820 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (91596) | 91596..91820 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (91596) | 91596..91820 | - | 225 | NuclAT_0 | - | Antitoxin |
| K5646_RS24410 (91832) | 91832..92551 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| K5646_RS24415 (92548) | 92548..92982 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| K5646_RS24420 (93037) | 93037..94995 | - | 1959 | WP_039000998.1 | ParB/RepB/Spo0J family partition protein | - |
| K5646_RS24425 (95060) | 95060..95293 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
| K5646_RS24430 (95350) | 95350..95889 | - | 540 | WP_032332913.1 | single-stranded DNA-binding protein | - |
| K5646_RS24435 (95915) | 95915..96121 | - | 207 | WP_000275853.1 | hypothetical protein | - |
| K5646_RS24915 (96362) | 96362..96589 | - | 228 | WP_071961421.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(M) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / floR / sul2 / tet(A) / sul3 / blaTEM-1B / aac(3)-IId / mcr-3.1 | - | 1..131843 | 131843 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T37444 WP_001372321.1 NZ_AP023307:c91519-91394 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T37444 NZ_AP023307:c91519-91394 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT37444 NZ_AP023307:c91820-91596 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|