Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 56094..56348 Replicon plasmid L-4567 strain 4[5]12:i:-
Accession NZ_AP023307
Organism Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain L-4567

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag K5646_RS24225 Protein ID WP_001312851.1
Coordinates 56094..56243 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 56287..56348 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K5646_RS24190 (52115) 52115..52615 + 501 Protein_63 Tn3 family transposase -
K5646_RS24195 (52649) 52649..52837 + 189 Protein_64 IS3 family transposase -
K5646_RS24200 (52912) 52912..53199 - 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin -
K5646_RS24205 (53196) 53196..53447 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
K5646_RS24210 (54413) 54413..55270 - 858 WP_039002220.1 incFII family plasmid replication initiator RepA -
K5646_RS24215 (55263) 55263..55337 - 75 WP_061357229.1 RepA leader peptide Tap -
K5646_RS24220 (55569) 55569..55826 - 258 WP_001541895.1 replication regulatory protein RepA -
K5646_RS24225 (56094) 56094..56243 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (56287) 56287..56348 + 62 NuclAT_1 - Antitoxin
- (56287) 56287..56348 + 62 NuclAT_1 - Antitoxin
- (56287) 56287..56348 + 62 NuclAT_1 - Antitoxin
- (56287) 56287..56348 + 62 NuclAT_1 - Antitoxin
K5646_RS24230 (56690) 56690..56902 - 213 WP_001541896.1 ANR family transcriptional regulator -
K5646_RS24235 (57037) 57037..57597 - 561 WP_000139310.1 fertility inhibition protein FinO -
K5646_RS24240 (57652) 57652..58395 - 744 WP_039002216.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(M) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / floR / sul2 / tet(A) / sul3 / blaTEM-1B / aac(3)-IId / mcr-3.1 - 1..131843 131843


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T37440 WP_001312851.1 NZ_AP023307:c56243-56094 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T37440 NZ_AP023307:c56243-56094 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACTGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT37440 NZ_AP023307:56287-56348 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References