Detailed information of TA system TA037373

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 1986866..1987135
• Replicon: chromosome
• Accession: NZ_AP023303
• Organism: Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain L-4526

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: K5618_RS09640
• Protein ID: WP_001372321.1
• Coordinates: 1987010..1987135 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	1986866..1986931 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
K5618_RS24620	1981888..1982160	+	273	WP_072118979.1	hypothetical protein	-
K5618_RS09610	1982401..1982607	+	207	WP_000275858.1	hypothetical protein	-
K5618_RS09615	1982633..1983172	+	540	WP_001825195.1	single-stranded DNA-binding protein	-
K5618_RS09620	1983235..1983468	+	234	WP_000005990.1	DUF905 family protein	-
K5618_RS09625	1983534..1985492	+	1959	WP_065800285.1	ParB/RepB/Spo0J family partition protein	-
K5618_RS09630	1985547..1985981	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
K5618_RS09635	1985978..1986697	+	720	WP_013362833.1	plasmid SOS inhibition protein A	-
-	1986709..1986933	+	225	NuclAT_0	-	-
-	1986709..1986933	+	225	NuclAT_0	-	-
-	1986709..1986933	+	225	NuclAT_0	-	-
-	1986709..1986933	+	225	NuclAT_0	-	-
-	1986866..1986931	+	66	-	-	Antitoxin
K5618_RS24625	1986919..1987068	+	150	Protein_1896	plasmid maintenance protein Mok	-
K5618_RS09640	1987010..1987135	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
K5618_RS24630	1987355..1987585	+	231	WP_001426396.1	hypothetical protein	-
K5618_RS24635	1987583..1987756	-	174	Protein_1899	hypothetical protein	-
K5618_RS24640	1987826..1988032	+	207	WP_000547968.1	hypothetical protein	-
K5618_RS09645	1988057..1988344	+	288	WP_000107544.1	hypothetical protein	-
K5618_RS09650	1988462..1989283	+	822	WP_001234469.1	DUF932 domain-containing protein	-
K5618_RS09655	1989580..1990227	-	648	WP_031943493.1	transglycosylase SLT domain-containing protein	-
K5618_RS09660	1990504..1990887	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
K5618_RS09665	1991078..1991764	+	687	WP_000332484.1	PAS domain-containing protein	-
K5618_RS09670	1991858..1992085	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integrative and Conjugative Element	qnrS1 / blaCTX-M-55 / catA2	-	1944563..2030806	86243

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T37373 WP_001372321.1 NZ_AP023303:1987010-1987135 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T37373 NZ_AP023303:1987010-1987135 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT37373 NZ_AP023303:1986866-1986931 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin