Detailed information of TA system TA037364

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 96107..96376
• Replicon: plasmid L-4445 strain 4[5]12:i:-
• Accession: NZ_AP023301
• Organism: Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain L-4445

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: K5630_RS24455
• Protein ID: WP_001372321.1
• Coordinates: 96251..96376 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	96107..96172 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
K5630_RS24920	91181..91408	+	228	WP_071961421.1	hypothetical protein	-
K5630_RS24425	91649..91855	+	207	WP_000275853.1	hypothetical protein	-
K5630_RS24430	91881..92420	+	540	WP_032332913.1	single-stranded DNA-binding protein	-
K5630_RS24435	92477..92710	+	234	WP_000005987.1	DUF905 family protein	-
K5630_RS24440	92775..94733	+	1959	WP_039000998.1	ParB/RepB/Spo0J family partition protein	-
K5630_RS24445	94788..95222	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
K5630_RS24450	95219..95938	+	720	WP_001276232.1	plasmid SOS inhibition protein A	-
-	95950..96174	+	225	NuclAT_0	-	-
-	95950..96174	+	225	NuclAT_0	-	-
-	95950..96174	+	225	NuclAT_0	-	-
-	95950..96174	+	225	NuclAT_0	-	-
-	96107..96172	+	66	-	-	Antitoxin
K5630_RS24925	96160..96309	+	150	Protein_119	plasmid maintenance protein Mok	-
K5630_RS24455	96251..96376	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
K5630_RS24930	96596..96826	+	231	WP_001426396.1	hypothetical protein	-
K5630_RS24935	96824..96997	-	174	Protein_122	hypothetical protein	-
K5630_RS24940	97067..97273	+	207	WP_000547968.1	hypothetical protein	-
K5630_RS24460	97298..97585	+	288	WP_000107535.1	hypothetical protein	-
K5630_RS24465	97708..98529	+	822	WP_072795862.1	DUF932 domain-containing protein	-
K5630_RS24470	98826..99428	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
K5630_RS24475	99749..100132	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
K5630_RS24480	100319..101008	+	690	WP_039002187.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	mcr-3.1 / aac(3)-IId / blaTEM-1B / sul3 / tet(A) / sul2 / floR / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M)	-	1..131843	131843

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T37364 WP_001372321.1 NZ_AP023301:96251-96376 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T37364 NZ_AP023301:96251-96376 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT37364 NZ_AP023301:96107-96172 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin