Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 96107..96376 | Replicon | plasmid L-4445 strain 4[5]12:i:- |
| Accession | NZ_AP023301 | ||
| Organism | Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain L-4445 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | K5630_RS24455 | Protein ID | WP_001372321.1 |
| Coordinates | 96251..96376 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 96107..96172 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K5630_RS24920 | 91181..91408 | + | 228 | WP_071961421.1 | hypothetical protein | - |
| K5630_RS24425 | 91649..91855 | + | 207 | WP_000275853.1 | hypothetical protein | - |
| K5630_RS24430 | 91881..92420 | + | 540 | WP_032332913.1 | single-stranded DNA-binding protein | - |
| K5630_RS24435 | 92477..92710 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
| K5630_RS24440 | 92775..94733 | + | 1959 | WP_039000998.1 | ParB/RepB/Spo0J family partition protein | - |
| K5630_RS24445 | 94788..95222 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| K5630_RS24450 | 95219..95938 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| - | 95950..96174 | + | 225 | NuclAT_0 | - | - |
| - | 95950..96174 | + | 225 | NuclAT_0 | - | - |
| - | 95950..96174 | + | 225 | NuclAT_0 | - | - |
| - | 95950..96174 | + | 225 | NuclAT_0 | - | - |
| - | 96107..96172 | + | 66 | - | - | Antitoxin |
| K5630_RS24925 | 96160..96309 | + | 150 | Protein_119 | plasmid maintenance protein Mok | - |
| K5630_RS24455 | 96251..96376 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| K5630_RS24930 | 96596..96826 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| K5630_RS24935 | 96824..96997 | - | 174 | Protein_122 | hypothetical protein | - |
| K5630_RS24940 | 97067..97273 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| K5630_RS24460 | 97298..97585 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| K5630_RS24465 | 97708..98529 | + | 822 | WP_072795862.1 | DUF932 domain-containing protein | - |
| K5630_RS24470 | 98826..99428 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| K5630_RS24475 | 99749..100132 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| K5630_RS24480 | 100319..101008 | + | 690 | WP_039002187.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mcr-3.1 / aac(3)-IId / blaTEM-1B / sul3 / tet(A) / sul2 / floR / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) | - | 1..131843 | 131843 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T37364 WP_001372321.1 NZ_AP023301:96251-96376 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T37364 NZ_AP023301:96251-96376 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT37364 NZ_AP023301:96107-96172 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|