Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 53973..54243 | Replicon | plasmid pYJ6-NDM5 |
Accession | NZ_AP023236 | ||
Organism | Escherichia coli strain YJ6 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | HXS64_RS22695 | Protein ID | WP_001312861.1 |
Coordinates | 54085..54243 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 53973..54036 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HXS64_RS22665 | 49684..50211 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
HXS64_RS22670 | 50269..50502 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
HXS64_RS22675 | 50563..52586 | + | 2024 | Protein_63 | ParB/RepB/Spo0J family partition protein | - |
HXS64_RS22680 | 52655..53089 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
HXS64_RS22685 | 53086..53805 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 53817..54041 | + | 225 | NuclAT_0 | - | - |
- | 53817..54041 | + | 225 | NuclAT_0 | - | - |
- | 53817..54041 | + | 225 | NuclAT_0 | - | - |
- | 53817..54041 | + | 225 | NuclAT_0 | - | - |
HXS64_RS22690 | 53826..54005 | - | 180 | WP_001309233.1 | hypothetical protein | - |
- | 53973..54036 | - | 64 | - | - | Antitoxin |
HXS64_RS22695 | 54085..54243 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
HXS64_RS22700 | 54481..54858 | - | 378 | Protein_68 | hypothetical protein | - |
HXS64_RS22705 | 55158..55454 | + | 297 | WP_001272251.1 | hypothetical protein | - |
HXS64_RS22710 | 55565..56386 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
HXS64_RS22715 | 56683..57285 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
HXS64_RS22720 | 57608..57991 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
HXS64_RS22725 | 58185..58856 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
HXS64_RS22730 | 58993..59220 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(B) / mph(A) / blaTEM-1B / rmtB / blaNDM-5 / sul1 / qacE / aadA2 / dfrA12 | - | 1..94613 | 94613 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T37039 WP_001312861.1 NZ_AP023236:54085-54243 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T37039 NZ_AP023236:54085-54243 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT37039 NZ_AP023236:c54036-53973 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|