Detailed information of TA system TA036980

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 73657..73890
• Replicon: plasmid pYJ3-a
• Accession: NZ_AP023228
• Organism: Escherichia coli strain YJ3

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: HXS63_RS23825
• Protein ID: WP_001312861.1
• Coordinates: 73657..73815 (-)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	73859..73890 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HXS63_RS23800	69031..69720	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
HXS63_RS23805	69907..70290	-	384	WP_001151524.1	relaxosome protein TraM	-
HXS63_RS23810	70611..71213	+	603	WP_013362798.1	transglycosylase SLT domain-containing protein	-
HXS63_RS23815	71510..72331	-	822	WP_001234426.1	DUF945 domain-containing protein	-
HXS63_RS23820	72449..72736	-	288	WP_000107535.1	hypothetical protein	-
HXS63_RS23825	73657..73815	-	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	73859..73890	-	32	NuclAT_1	-	Antitoxin
-	73859..73890	-	32	NuclAT_1	-	Antitoxin
-	73859..73890	-	32	NuclAT_1	-	Antitoxin
-	73859..73890	-	32	NuclAT_1	-	Antitoxin
HXS63_RS23830	73915..75286	-	1372	Protein_93	IS3-like element IS150 family transposase	-
-	75334..75531	-	198	NuclAT_0	-	-
-	75334..75531	-	198	NuclAT_0	-	-
-	75334..75531	-	198	NuclAT_0	-	-
-	75334..75531	-	198	NuclAT_0	-	-
HXS63_RS23835	75343..75531	+	189	WP_001299721.1	hypothetical protein	-
HXS63_RS23840	75543..76262	-	720	WP_001276238.1	plasmid SOS inhibition protein A	-
HXS63_RS23845	76259..76693	-	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
HXS63_RS23850	76748..76945	-	198	Protein_97	hypothetical protein	-
HXS63_RS23855	76973..77206	-	234	WP_000005990.1	DUF905 family protein	-
HXS63_RS23860	77274..77771	-	498	WP_042039995.1	single-stranded DNA-binding protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aadA5 / qacE / sul1 / mph(A) / erm(B) / sitABCD / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / tet(B) / catA1	iutA / iucD / iucC / iucB / iucA	1..170909	170909
	-	inside	Integron	-	iutA / iucD / iucC / iucB / iucA	1..170909	170908

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T36980 WP_001312861.1 NZ_AP023228:c73815-73657 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

>T36980 NZ_AP023228:c73815-73657 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 32 bp

>AT36980 NZ_AP023228:c73890-73859 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin