Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 51782..52036 | Replicon | plasmid pMTY18530-2 |
Accession | NZ_AP023192 | ||
Organism | Escherichia coli strain TUM18530 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | HUV24_RS24785 | Protein ID | WP_001351576.1 |
Coordinates | 51782..51988 (-) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 51975..52036 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUV24_RS24745 | 47334..47735 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
HUV24_RS24750 | 47668..47925 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
HUV24_RS24755 | 48018..48671 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
HUV24_RS24760 | 48769..48909 | - | 141 | WP_001333237.1 | hypothetical protein | - |
HUV24_RS24765 | 49610..50467 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
HUV24_RS24770 | 50460..50942 | - | 483 | WP_001273588.1 | hypothetical protein | - |
HUV24_RS24775 | 50935..51009 | - | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
HUV24_RS24780 | 51241..51498 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
HUV24_RS24785 | 51782..51988 | - | 207 | WP_001351576.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 51975..52036 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 51975..52036 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 51975..52036 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 51975..52036 | + | 62 | NuclAT_1 | - | Antitoxin |
HUV24_RS24790 | 52292..52366 | - | 75 | Protein_61 | endonuclease | - |
HUV24_RS24795 | 52612..52824 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
HUV24_RS24800 | 52960..53520 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
HUV24_RS24805 | 53623..54483 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
HUV24_RS24810 | 54542..55288 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / blaCTX-M-55 / sitABCD | iutA / iucD / iucC / iucB / iucB / iucA | 1..115543 | 115543 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7826.31 Da Isoelectric Point: 8.8807
>T36818 WP_001351576.1 NZ_AP023192:c51988-51782 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T36818 NZ_AP023192:c51988-51782 [Escherichia coli]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT36818 NZ_AP023192:51975-52036 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|